Recombinant Laccaria bicolor Solute carrier family 25 member 38 homolog (LACBIDRAFT_191230)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please specify it in your order notes. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery estimates.
Note: All protein shipments default to standard blue ice packs. If you require dry ice shipment, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
LACBIDRAFT_191230; Mitochondrial glycine transporter; Solute carrier family 25 member 38 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) (Bicoloured deceiver) (Laccaria laccata var. bicolor)
Target Names
LACBIDRAFT_191230
Target Protein Sequence
MSNVGQQLLSGGLSGLATTVCLQPFDLLKTRLQQGDGSTWRPTRPHTSIILDITRDVIHS GGWRGLWRGTTPSLVRNVPGVALYMTSLTQLRALMATSPYFASLRRRPQNGDANKNTSSV LPKLTSQGNLIAGATTRVGVGFLLNPFSVLKARFESNIYAYESLTGAFGTIVRQGPSELL RGFLASSLRDAPYAGLFVVFYEGIKHEASYVLPPVTSTQATLIHGLSAASAGAIATMATH PFDVIKTKIQVRTEAQYHGFLTTIATIWKQRGITGYFDGASLRMSRKVLSSAIGWAVYEG GLMLMRTST
Uniprot No.

Target Background

Function
This mitochondrial glycine transporter facilitates the import of glycine into the mitochondrial matrix. It plays a crucial role in supplying glycine for the initial enzymatic step in heme biosynthesis. This step involves the condensation of glycine with succinyl-CoA to produce 5-aminolevulinate (ALA) within the mitochondrial matrix.
Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family, SLC25A38 subfamily
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Laccaria bicolor and why is it significant to research?

Laccaria bicolor (Maire) P.D. Orton is an ectomycorrhizal fungus that establishes symbiotic relationships with various woody host plants. These plant-fungus associations play fundamental roles in forest ecology, influencing tree growth, water and nutrient absorption, and providing protection against root diseases. L. bicolor is characterized by its ubiquitous geographical distribution and lack of strict host specificity, making it an excellent model organism for studying symbiotic relationships .

The significance of L. bicolor in research is enhanced by its ability to colonize seedlings and adult conifer and hardwood trees. Its adaptability has been attributed to its relatively large genome, which contains an extensive fungal gene repertoire and numerous gene families compared to other ectomycorrhizal fungi, facilitating its adaptation to various hosts . The availability of a whole-genome sequence has provided researchers with considerable genomic resources for systematic identification and characterization of genes and proteins of interest .

What is the Solute Carrier Family 25 Member 38 Homolog in Laccaria bicolor?

The Solute Carrier Family 25 Member 38 Homolog (LACBIDRAFT_191230) is a protein identified in the L. bicolor genome. Based on its classification in the solute carrier family 25, this protein likely functions as a mitochondrial carrier protein involved in the transport of various substrates across the inner mitochondrial membrane .

The protein is characterized by the UniProt accession number B0DK57 and is derived from Laccaria bicolor strain S238N-H82 / ATCC MYA-4686, also known as Bicoloured deceiver or Laccaria laccata var. bicolor. The complete amino acid sequence of this protein consists of 309 amino acids, with the expression region spanning positions 1-309, indicating it is a full-length protein .

What are the recommended storage conditions for the Recombinant LACBIDRAFT_191230 protein?

The Recombinant LACBIDRAFT_191230 protein should be stored in a Tris-based buffer containing 50% glycerol, which has been optimized specifically for this protein. For short-term storage, the protein can be kept at -20°C, while for extended storage periods, it is recommended to conserve the protein at either -20°C or -80°C .

For working with the protein, it is advised to prepare aliquots that can be stored at 4°C for up to one week. Repeated freezing and thawing cycles should be avoided as this can lead to protein degradation and loss of biological activity. This precaution is critical for maintaining the structural integrity and functional properties of the protein during experimental procedures .

How should randomization be implemented in experimental designs using this recombinant protein?

When designing experiments involving the Recombinant LACBIDRAFT_191230 protein, formal randomization processes should be implemented to allocate experimental units (e.g., cell cultures, plant samples) to different treatment groups. This approach reduces bias in assigning units to treatment groups, increasing the likelihood that groups are comparable and that observed differences in outcome measures can be attributed to the experimental procedures rather than pre-existing differences .

Random allocation requires a systematic, physical approach such as using a table of random numbers or computer-generated random sequences, rather than haphazard selection. According to survey data of published biomedical research, only 12% of studies reported using randomization, with only 9% of those providing details on the method used . Therefore, researchers working with this protein should clearly document their randomization methods to enhance the reproducibility and validity of their findings.

What blinding procedures should be implemented in qualitative assessments of experiments with this protein?

When conducting experiments with the Recombinant LACBIDRAFT_191230 protein that involve qualitative scoring or subjective assessments, blinding procedures should be implemented to minimize bias. Blinding ensures that researchers do not know which treatment has been applied when judging experimental results, which is particularly important for qualitative measures that may be susceptible to subjective interpretation .

Survey data indicates that only 14% of papers using qualitative scores reported implementing blinding protocols . Researchers working with this protein should ensure that samples are coded by a colleague not involved in the assessment, or use automated systems that mask treatment identities until after data collection is complete. This approach significantly enhances the reliability of research findings and should be explicitly reported in methodological descriptions.

How can factorial experimental designs be applied to studies involving LACBIDRAFT_191230?

Factorial experimental designs can be effectively applied to studies involving the Recombinant LACBIDRAFT_191230 protein to evaluate combinations of two or more experimental variables simultaneously. This approach allows researchers to assess not only the main effects of each factor but also their interactions, providing a more comprehensive understanding of the protein's behavior under various conditions .

For example, researchers might design an experiment that simultaneously evaluates:

  • Different concentrations of the recombinant protein

  • Various environmental conditions (pH, temperature)

  • Presence of potential cofactors or inhibitors

  • Different host plant species or genotypes (when studying mycorrhizal interactions)

This design is particularly efficient for maximizing information gained from each experiment while minimizing the number of experimental units required. When reporting such studies, researchers should clearly document the design factors, their levels, and the randomization procedures used to assign experimental units to treatment combinations .

What approaches can be used to study the functional role of LACBIDRAFT_191230 in symbiotic relationships?

To investigate the functional role of the Recombinant LACBIDRAFT_191230 protein in symbiotic relationships between Laccaria bicolor and host plants, researchers can employ several complementary approaches:

  • Gene knockout/knockdown studies: Creating L. bicolor strains with modified expression of the LACBIDRAFT_191230 gene to assess the impact on symbiosis establishment and function.

  • Protein localization studies: Using fluorescently tagged versions of the protein to determine its subcellular localization during different stages of symbiotic interaction.

  • Comparative genomics: Analyzing the conservation and evolution of this protein across different ectomycorrhizal fungi to infer its importance in symbiotic relationships.

  • Single-case experimental designs: Implementing reversal designs (A-B-A-B) where conditions alternate between baseline and experimental treatments to establish causal relationships between the protein's activity and specific symbiotic outcomes .

When studying the protein's role in symbiosis, researchers should consider the ecological context, as L. bicolor has been shown to persist for extended periods (up to 10 years) after introduction to forest plantations, potentially affecting indigenous fungal populations .

How can transposable elements affect the expression and function of LACBIDRAFT_191230?

Transposable elements (TEs) can significantly impact the expression and function of genes like LACBIDRAFT_191230 in Laccaria bicolor. The L. bicolor genome contains numerous TEs that have been systematically identified through specific annotation pipelines . These mobile genetic elements can influence gene expression and function through several mechanisms:

  • Insertional mutagenesis: TEs can insert into the coding or regulatory regions of the LACBIDRAFT_191230 gene, potentially disrupting its expression or altering protein structure.

  • Epigenetic regulation: TEs can trigger epigenetic modifications (e.g., DNA methylation, histone modifications) that affect the chromatin structure around the gene, potentially silencing or enhancing its expression.

  • Alternative splicing: TE insertions can create new splice sites or disrupt existing ones, leading to alternative transcript variants of the gene.

  • Regulatory network alterations: TEs can introduce new regulatory elements that affect the gene's response to environmental stimuli or developmental cues.

Researchers studying LACBIDRAFT_191230 should consider screening for TE insertions near or within this gene and evaluating their potential impact on gene expression and protein function, particularly when comparing different L. bicolor strains or populations .

What control samples should be included in experiments using Recombinant LACBIDRAFT_191230?

When designing experiments with the Recombinant LACBIDRAFT_191230 protein, appropriate controls should be included to ensure valid interpretation of results. Essential controls include:

  • Negative controls:

    • Buffer-only treatments (containing the same Tris-based buffer with 50% glycerol but without the recombinant protein)

    • Inactive protein controls (heat-denatured or otherwise inactivated LACBIDRAFT_191230)

    • Non-related proteins of similar size and structure

  • Positive controls:

    • Known functional homologs from related species

    • Previously characterized proteins with similar functions

  • Concentration gradients:

    • Multiple concentrations of the recombinant protein to establish dose-response relationships

  • Time-course controls:

    • Measurements at multiple time points to capture temporal dynamics

To establish experimental control and reduce threats to internal validity, the order of assignment of treatments can be randomized, and when possible, the intervention and data collection should be blinded .

How should reversal designs be implemented in single-case experimental studies with this protein?

Reversal designs, particularly useful for single-case experimental studies with the Recombinant LACBIDRAFT_191230 protein, collect outcome data in at least two phases: a baseline or no-treatment phase (labeled as 'A') and the experimental or treatment phase (labeled as 'B'). This design type is valuable when studying the protein's effects on specific biological processes or symbiotic interactions .

A typical implementation might follow an A-B-A-B pattern where:

  • A1: Initial baseline measurements without the recombinant protein

  • B1: First intervention phase with the protein

  • A2: Return to baseline conditions (protein withdrawn)

  • B2: Reintroduction of the protein

Ideally, three replications of treatment effects (A1 vs B1, B1 vs A2, A2 vs B2) should be used to demonstrate experimental control. This approach is particularly valuable for establishing causal relationships between the protein's presence and observed effects .

The data can be visually represented in a graph showing the replications of treatment effects across multiple experimental units or participants, similar to the hypothetical results described in the literature for this type of design .

What statistical approaches are appropriate for analyzing data from experiments with LACBIDRAFT_191230?

When analyzing data from experiments involving the Recombinant LACBIDRAFT_191230 protein, researchers should select statistical approaches that align with their experimental design and data characteristics. Appropriate statistical methods include:

  • For comparative studies:

    • Analysis of Variance (ANOVA) for comparing multiple treatment groups

    • t-tests for comparing two groups

    • Non-parametric alternatives (e.g., Mann-Whitney U test, Kruskal-Wallis test) for data that violate normality assumptions

  • For dose-response relationships:

    • Regression analysis

    • Curve fitting (e.g., logistic, sigmoidal)

  • For time-course experiments:

    • Repeated measures ANOVA

    • Mixed-effects models to account for within-subject correlations

  • For single-case experimental designs:

    • Visual analysis of graphed data

    • Calculation of effect sizes

    • Randomization tests

    • Non-overlap indices (e.g., percentage of non-overlapping data)

When reporting statistical analyses, researchers should clearly document the statistical tests used, the rationale for their selection, and comprehensive results including effect sizes and confidence intervals, not just p-values. This level of detail enhances the reproducibility and interpretability of research findings .

How does LACBIDRAFT_191230 compare to similar proteins in other ectomycorrhizal fungi?

The Solute Carrier Family 25 Member 38 Homolog (LACBIDRAFT_191230) in Laccaria bicolor likely shares structural and functional similarities with homologous proteins in other ectomycorrhizal fungi, though specific comparative data is not provided in the search results. Based on the general characteristics of L. bicolor, which has "the largest fungal gene repertoire and an abundance of multiple gene families relative to other ectomycorrhizal fungi," this protein may have unique features or adaptations that contribute to L. bicolor's broad host range and adaptability .

Researchers investigating this protein should conduct comparative genomic and proteomic analyses across various ectomycorrhizal fungi species to identify:

  • Sequence conservation and divergence

  • Structural similarities and differences

  • Potential functional adaptations related to host specificity

  • Expression patterns under various symbiotic conditions

Such comparative analyses would provide valuable insights into the evolution of this protein family and its role in symbiotic relationships across different fungal species.

What role might LACBIDRAFT_191230 play in the persistence of Laccaria bicolor in forest ecosystems?

The potential role of LACBIDRAFT_191230 in the persistence of Laccaria bicolor in forest ecosystems can be inferred from studies on L. bicolor strain persistence. Research has shown that L. bicolor strains can persist for up to 10 years after outplanting in forest plantations, with different strains showing varying patterns of persistence and spread .

As a member of the solute carrier family, LACBIDRAFT_191230 might contribute to this persistence through several mechanisms:

  • Nutrient acquisition and utilization: By facilitating the transport of essential substrates across mitochondrial membranes, this protein could enhance the fungus's metabolic efficiency in various soil conditions.

  • Adaptation to host plants: The protein might play a role in the fungus's ability to establish symbiotic relationships with multiple host species, contributing to its lack of strict host specificity.

  • Environmental stress response: Transport proteins often play crucial roles in stress responses, potentially helping L. bicolor adapt to changing environmental conditions in forest ecosystems.

  • Competitive interactions: Efficient metabolic processes supported by this transporter might provide L. bicolor with competitive advantages against indigenous fungal populations.

Studies examining the expression patterns of LACBIDRAFT_191230 under various ecological conditions and in different L. bicolor strains (such as the American strain S238N and French strain 81306) could provide insights into its role in persistence and adaptation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.