Recombinant Lachancea kluyveri Cytochrome c oxidase subunit 3 (COX3)

Shipped with Ice Packs
In Stock

Description

Evolutionary and Genomic Context

  • Intron Content: The COX1 gene in L. kluyveri contains three introns, with the third being twice as large as in L. thermotolerans. These introns encode LAGLIDADG family endonucleases .

  • Phylogenetic Utility: COX3 sequences are highly variable, making them effective markers for resolving close lineages in species like Babesia. The COX3 gene outperforms 18S rRNA and cytochrome b (COB) in interspecies differentiation .

Functional Role in COX Complex

COX3 is indispensable for the structural integrity and catalytic activity of COX. In mammalian systems, COX3 interacts with nuclear-encoded subunits (e.g., COX5A, COX6B) during enzyme assembly. Key findings include:

  • Catalytic Core Stabilization: COX3 interacts with COX1 and COX2 to form the binuclear center (BNC), critical for oxygen reduction to water .

  • Proton Pumping Efficiency: COX3 deficiency reduces proton translocation stoichiometry, impacting ATP production .

  • Tissue-Specific Regulation: Nuclear-encoded subunits like COX5A modulate COX activity in response to metabolic demands (e.g., thyroid hormone interactions) .

Research Applications

Recombinant COX3 is utilized in:

  • Structural Studies: His-tagged COX3 facilitates crystallization and NMR studies to elucidate subunit interactions .

  • Phylogenetic Analysis: COX3 sequences resolve evolutionary relationships in Babesia and Lachancea species due to high nucleotide variability .

  • Disease Modeling: Mutations in COX subunits or assembly factors are linked to mitochondrial disorders, providing insights into pathogenic mechanisms .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will do our best to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributors.
All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend centrifuging the vial briefly prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can serve as a reference for your application.
Shelf Life
The shelf life of our products depends on various factors including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development for your order.
Synonyms
COX3; Cytochrome c oxidase subunit 3; Cytochrome c oxidase polypeptide III
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-269
Protein Length
full length protein
Species
Lachancea kluyveri (strain ATCC 58438 / CBS 3082 / CCRC 21498 / NBRC 1685 / JCM 7257 / NCYC 543 / NRRL Y-12651) (Yeast) (Saccharomyces kluyveri)
Target Names
COX3
Target Protein Sequence
MTHLERSRHQQFPFHLVAPSPWPIVVSFSLLSLALSLALAMHGYIGNMNLVWLALFVLTS SATLWFRDIIAEATYLGDHTIAVRKGINLGFLLFVVSEVLIFAGLFWAYFHSAMSPTIEL GGVWPPVGIEAVQPTELPLLNTIILLASGATVTYSHHALIQGNRKDALSGLFITTWLIII FVICQYIEYTNATFTISDGVYGSVFYAGTGLHFLHMVMLATMLAINYWRLRNYHLTSSHH VGYETTVIYLHVLDIIWLFLYIVFYWWGV
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 3 (COX3) is a crucial component of cytochrome c oxidase, the final enzyme in the mitochondrial electron transport chain. This chain drives oxidative phosphorylation, a fundamental process in cellular energy production. The respiratory chain comprises three multisubunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII), and cytochrome c oxidase (complex IV, CIV). These complexes work cooperatively to transfer electrons derived from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient powers transmembrane transport and ATP synthase, the enzyme responsible for ATP production. Cytochrome c oxidase is the key player in the respiratory chain that catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space (IMS) are transferred through the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1. This active site is a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to two water molecules using four electrons from cytochrome c in the IMS and four protons from the mitochondrial matrix.
Protein Families
Cytochrome c oxidase subunit 3 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

How does L. kluyveri COX3 compare to homologous proteins in other yeast species?

L. kluyveri COX3 shares structural and functional similarities with homologous proteins in other yeast species, but with distinct evolutionary characteristics. L. kluyveri (previously known as Saccharomyces kluyveri) diverged from Saccharomyces cerevisiae after the Whole Genome Duplication (WGD) event, which marks the separation of the Saccharomyces genus from Lachancea . This evolutionary divergence has implications for the structure and function of its proteins, including COX3.

Comparative analysis reveals that while the core functional domains are conserved, L. kluyveri COX3 exhibits species-specific adaptations that may correlate with the organism's unique metabolic characteristics, such as its weak Crabtree positive nature (fermenting only under oxygen-limiting conditions) and its ability to produce ethyl acetate as a major overflow metabolite in aerobic conditions .

Unlike S. cerevisiae, which undergoes fermentation even in the presence of oxygen (strong Crabtree effect), L. kluyveri has a more efficient respiratory metabolism, potentially reflecting differences in the assembly and function of its respiratory complexes, including those involving COX3 .

What are the recommended storage and handling conditions for recombinant L. kluyveri COX3?

For optimal stability and activity of recombinant L. kluyveri COX3, the following storage and handling conditions are recommended:

  • Primary storage: Store at -20°C for regular use or -80°C for extended storage

  • Working aliquots: Store at 4°C for up to one week

  • Storage buffer: Tris-based buffer with 50% glycerol, optimized specifically for this protein

  • Avoid repeated freeze-thaw cycles: This can significantly diminish protein activity and stability

  • Recommended quantity: Available in 50 μg packages, with other quantities available for specific research needs

When planning experiments requiring sustained COX3 activity, researchers should prepare small working aliquots to minimize freeze-thaw cycles and maintain the protein in appropriate buffer conditions that preserve its native conformation.

How does the genomic context of L. kluyveri influence COX3 expression and evolution?

The genomic context of L. kluyveri exhibits remarkable chromosome-scale heterogeneity that likely influences COX3 expression and evolution. Population genomics studies have revealed that L. kluyveri underwent a large introgression event of approximately 1 Mb of GC-rich sequence in its chromosomal arm, which occurred in the last common ancestor of all L. kluyveri strains . This region displays distinct molecular evolution patterns compared to the rest of the genome.

Key characteristics of this genomic heterogeneity include:

  • Differential recombination rates: The introgressed GC-rich region exhibits a higher recombination rate than the rest of the genome

  • Biased substitution patterns: The region shows a dramatically elevated A:T → G:C substitution rate, indicating increased GC-biased gene conversion

  • Persistent compositional heterogeneity: Analysis predicts that this chromosome-scale heterogeneity will persist even after the genome reaches mutational equilibrium

If the COX3 gene is located within or near this distinctive genomic region, its expression and evolutionary trajectory may be subject to different selective pressures and mutation rates compared to genes in other regions. This could potentially influence:

  • Codon usage patterns

  • Transcriptional regulation

  • Rate of protein evolution

  • Functional adaptations specific to L. kluyveri's unique metabolic profile

These genomic particularities make L. kluyveri an excellent model to study how distinct recombination and substitution regimes can coexist within a single genome and potentially affect the expression and function of important respiratory proteins like COX3 .

What methodologies are most effective for studying COX3 assembly in L. kluyveri?

Studying COX3 assembly in L. kluyveri requires a multifaceted approach that leverages techniques proven effective in related yeast species while accounting for L. kluyveri's unique characteristics. Effective methodologies include:

  • Metabolic labeling with affinity purification: This approach has been successfully used to track newly synthesized mitochondrial gene products and identify assembly intermediates. By following the kinetic relationship between Cox1, Cox2, and Cox3, researchers can map the stepwise assembly pathway .

  • Comparative genomics and proteomics: By comparing COX3 assembly factors between L. kluyveri and well-studied species like S. cerevisiae, researchers can identify conserved and divergent assembly pathways.

  • BN-PAGE (Blue Native Polyacrylamide Gel Electrophoresis): This technique allows separation of intact protein complexes and identification of assembly intermediates in their native state.

  • Pulse-chase experiments: These can determine the temporal sequence of subunit incorporation and complex formation.

  • Fluorescence microscopy with tagged assembly factors: This approach enables visualization of the spatial and temporal aspects of COX3 assembly in living cells.

  • Genetic approaches: Creating targeted mutations in assembly factors and analyzing their effects on COX3 incorporation into functional complexes.

A comprehensive study of COX3 assembly should include analysis of the roles of specific chaperones and structural subunits that associate with mitochondrial gene products during the assembly process .

How does COX3 contribute to L. kluyveri's weak Crabtree effect and unique metabolic profile?

L. kluyveri is characterized as a weak Crabtree positive yeast, meaning it predominantly uses respiratory metabolism when oxygen is available and only shifts to fermentation under oxygen-limiting conditions . This differs from S. cerevisiae, which exhibits a strong Crabtree effect (fermentation even in the presence of oxygen). The respiratory chain, including COX3, likely plays a central role in this metabolic characteristic.

COX3's contribution to this phenotype may include:

  • Enhanced respiratory efficiency: The structure and function of COX3 in L. kluyveri may contribute to more efficient electron transport, allowing greater biomass production compared to S. cerevisiae .

  • Metabolic flexibility: L. kluyveri can utilize both traditional carbon sources and unique nitrogen sources like purines and pyrimidines, suggesting specialized metabolic pathways potentially linked to respiratory function .

  • Overflow metabolism regulation: Under aerobic conditions, L. kluyveri produces ethyl acetate rather than ethanol as its primary overflow metabolite. This unique characteristic may be influenced by the balance between respiratory and fermentative metabolism, in which COX3 function is implicated .

  • Integration with unique pyrimidine catabolism: L. kluyveri possesses a distinctive URC pyrimidine catabolism pathway. The connection between this pathway and respiratory metabolism may involve COX3 function, particularly in energy generation during growth on alternative nitrogen sources .

Research approaches to investigate these relationships could include:

  • Comparative flux analysis between wild-type and COX3-modified strains

  • Growth studies under varying oxygen conditions

  • Metabolomic profiling during growth on different carbon and nitrogen sources

  • Analysis of respiratory complex assembly and function in relation to metabolic shifts

What experimental designs best elucidate the relationship between COX3 function and unique metabolic characteristics of L. kluyveri?

To investigate the relationship between COX3 function and L. kluyveri's distinctive metabolic features, researchers should consider the following experimental designs:

  • Genome-scale metabolic model integration: The existing iPN730 genome-scale metabolic model for L. kluyveri comprises 1235 reactions, 1179 metabolites, and 730 genes distributed across 8 compartments . This model can be leveraged to:

    • Predict flux distributions under varying COX3 expression levels

    • Simulate growth and product formation in COX3 mutants

    • Identify metabolic pathways most sensitive to changes in respiratory capacity

  • Dynamic Flux Balance Analysis (DFBA): This approach can reveal how COX3 functionality influences:

    • Growth dynamics under varying oxygen conditions

    • Substrate utilization patterns

    • Production of metabolites like ethyl acetate

  • Phenotypic phase plane analysis: This method can quantify the energetic cost penalty of producing different metabolites (like ethyl acetate and ethanol) on the specific growth rate, illuminating how respiratory efficiency linked to COX3 affects metabolic trade-offs .

  • Context-specific metabolic models: Generating models of L. kluyveri growing on different nitrogen sources (e.g., uracil vs. ammonium salts) can highlight pathways associated with specialized metabolism that may interface with respiratory function .

  • Comparative systems biology: Cross-species analysis of respiratory chain function between L. kluyveri and related yeasts can identify unique adaptations in electron transport and energy generation.

  • Oxygen-limited chemostat experiments: Controlled growth under precisely defined oxygen limitations can reveal thresholds for metabolic shifts and their relationship to COX3 function.

Experimental ApproachPrimary MeasurementsKey Insights Generated
Genome-scale modelingPredicted flux distributions, growth ratesSystem-wide effects of COX3 function
DFBATime-course metabolite concentrationsDynamic response to changing oxygen availability
Phenotypic phase planeGrowth rate vs. metabolite productionTrade-offs between respiration and fermentation
Oxygen-limited chemostatsRespiratory quotient, gene expressionThresholds for metabolic shifts
Isotope labeling studiesCarbon flux through central metabolismAlternative pathway usage with COX3 variants

How can researchers effectively investigate COX3's role in L. kluyveri's unique pyrimidine catabolism pathway?

L. kluyveri has been extensively studied for its unique URC pyrimidine catabolism pathway, which allows it to utilize purines and pyrimidines as sole nitrogen sources . Investigating COX3's potential role in this process requires sophisticated experimental approaches:

  • Differential flux analysis: Using flux variability analysis (FVA) to compare wild-type and COX3-modified strains can highlight pathways potentially connected to pyrimidine metabolism, including:

    • Purine metabolism

    • Histidine metabolism

    • Riboflavin metabolism

    • Pyrimidine metabolism

  • Integration of transcriptomic data: Gene expression analysis comparing growth on uracil versus ammonium salts as nitrogen sources can reveal regulatory connections between respiratory function and pyrimidine utilization.

  • Mitochondrial isolation and functional assays: Since both respiratory function and aspects of pyrimidine metabolism occur in mitochondria, isolated organelle studies can reveal functional connections between these pathways.

  • In vivo respiratory measurements: Oxygen consumption analysis during growth on different nitrogen sources can quantify how respiratory chain function adapts to pyrimidine catabolism.

  • Genetic interaction mapping: Systematic double mutant analysis combining COX3 modifications with mutations in pyrimidine catabolism genes can reveal functional relationships through epistatic effects.

  • Metabolic profiling: Untargeted and targeted metabolomics approaches can identify metabolic intermediates that connect respiratory function and pyrimidine catabolism.

The experimental design should account for the fact that L. kluyveri can assimilate and ferment alternative sugars like melibiose , which may interact with its unique nitrogen metabolism pathways.

What are the challenges and solutions in studying COX3's interactions with other electron transport chain components in L. kluyveri?

Studying COX3's interactions with other electron transport chain (ETC) components in L. kluyveri presents several technical and biological challenges. Here are the key challenges and methodological solutions:

Challenges:

  • Mitochondrial membrane protein complexity: The hydrophobic nature of COX3 and other ETC components makes isolation while maintaining native interactions difficult.

  • Assembly intermediates: The stepwise assembly of cytochrome c oxidase involves multiple chaperones and assembly factors that may be species-specific .

  • Dynamic nature of interactions: ETC component interactions may change under different metabolic conditions relevant to L. kluyveri's unique metabolism.

  • Limited established protocols: While methodologies exist for model organisms like S. cerevisiae, they may require significant adaptation for L. kluyveri.

Methodological Solutions:

  • Crosslinking mass spectrometry (XL-MS): This approach can capture transient interactions between COX3 and other ETC components by creating covalent bonds before purification.

  • Cryo-electron microscopy: High-resolution structural analysis of purified respiratory complexes can reveal the precise positioning of COX3 within the assembled complex.

  • Affinity purification followed by sensitive detection methods:

    • Metabolic labeling

    • Affinity tags on COX3 or interacting partners

    • Mass spectrometry identification of co-purifying proteins

  • Blue Native PAGE combined with second-dimension SDS-PAGE: This approach separates intact complexes followed by subunit identification.

  • Proximity labeling approaches: Techniques like BioID or APEX2 can identify proteins in close proximity to COX3 in living cells.

  • Genetic approaches to track assembly:

    • Creation of conditional mutants in assembly factors

    • Genomic tagging of assembly intermediates

    • Time-course analysis of complex formation

When investigating COX3 assembly in L. kluyveri, researchers should pay particular attention to the kinetic relationship between Cox1, Cox2, and Cox3 incorporation into the complete cytochrome c oxidase complex, as this has been shown to follow a specific stepwise assembly pathway in related yeasts .

How might genomic heterogeneity in L. kluyveri impact COX3 expression and function across different strains?

The significant genomic heterogeneity observed in L. kluyveri populations likely has profound impacts on COX3 expression and function across different strains. Population genomics studies reveal several factors that could influence COX3:

  • Introgression events: A large introgression of approximately 1 Mb of GC-rich sequence occurred in a chromosomal arm of the last common ancestor of all L. kluyveri strains . If the COX3 gene is located within or near this region, it may be subject to:

    • Different mutational pressures

    • Altered recombination rates

    • Distinct selective constraints

  • Substitution rate heterogeneity: The introgressed region displays a dramatically elevated A:T → G:C substitution rate, the signature of increased GC-biased gene conversion . This could affect:

    • Codon usage in the COX3 gene

    • Protein sequence evolution

    • mRNA stability and expression levels

  • Recombination rate variation: The higher recombination rate in the GC-rich region could lead to greater genetic diversity in genes located there , potentially resulting in:

    • Greater functional variation in COX3 across strains

    • Distinct haplotypes with varying functional properties

    • Different patterns of linkage with other genes

  • Single nucleotide polymorphisms: With 6.5 million SNPs identified across L. kluyveri populations , there is considerable potential for strain-specific variations in COX3 that could impact:

    • Protein structure and stability

    • Interactions with other respiratory complex components

    • Assembly efficiency and regulation

Researchers investigating strain differences in COX3 function should consider these genomic particularities and employ approaches that can detect subtle functional variations, such as:

  • Comparative growth analysis under respiratory conditions

  • Oxygen consumption measurements

  • Protein expression and stability assays

  • Assembly efficiency comparisons

  • Detailed analysis of respiratory complex composition and activity

The chromosome-scale compositional heterogeneity in L. kluyveri is predicted to persist even after the genome reaches mutational equilibrium , suggesting that strain differences in COX3 may represent evolutionarily stable adaptations rather than transient variations.

How can L. kluyveri COX3 research contribute to broader understanding of mitochondrial evolution?

Research on L. kluyveri COX3 offers unique insights into mitochondrial evolution due to the organism's evolutionary position and distinctive genomic characteristics. Key contributions include:

  • Evolutionary transition insights: L. kluyveri diverged from S. cerevisiae after the Whole Genome Duplication (WGD) event, making it valuable for understanding how respiratory chain components evolved following this major genomic event .

  • Mosaic genome effects: The introgression event that created the GC-rich region in L. kluyveri's genome represents a natural experiment in how mitochondrial genes may adapt to different mutational environments within the same nuclear genome .

  • Metabolic adaptation model: The weak Crabtree effect in L. kluyveri provides a model for studying how respiratory chain components like COX3 adapt to different metabolic strategies .

  • Assembly pathway conservation: Comparative analysis of COX3 assembly between L. kluyveri and other yeasts can reveal which aspects of respiratory complex formation are evolutionarily conserved versus lineage-specific .

Future research directions that could enhance our understanding of mitochondrial evolution include:

  • Detailed comparative genomics of respiratory chain genes across the Lachancea genus

  • Experimental evolution studies tracking COX3 adaptation to different selective pressures

  • Functional complementation experiments between COX3 orthologs from different yeast species

  • Analysis of nuclear-mitochondrial co-evolution patterns in L. kluyveri populations

What potential biotechnological applications might emerge from understanding L. kluyveri COX3 function?

Understanding L. kluyveri COX3 function could enable several biotechnological applications, particularly leveraging the organism's unique metabolic characteristics:

  • Improved bioethanol production: L. kluyveri's weak Crabtree effect results in more efficient biomass production compared to S. cerevisiae . Engineering respiratory efficiency through COX3 modifications could create strains with optimized fermentation characteristics.

  • Ethyl acetate bioproduction: L. kluyveri naturally produces ethyl acetate as a major overflow metabolite under aerobic conditions . Understanding how respiratory function influences this process could allow development of optimized production strains for this valuable industrial compound.

  • Pyrimidine-derived compound synthesis: L. kluyveri's ability to utilize purines and pyrimidines as sole nitrogen sources could be leveraged for biocatalytic conversion of nucleobase-containing waste streams into valuable products.

  • Stress-resistant production strains: Insights into how L. kluyveri's respiratory chain functions under different conditions could inform development of industrial strains with enhanced tolerance to process stresses.

  • Metabolic engineering platforms: The genome-scale metabolic model iPN730 combined with knowledge of respiratory function could provide a foundation for rational strain design for diverse biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.