L. kluyveri Dihydroorotate dehydrogenase (URA9) is classified as a Class-II DHODH enzyme (EC 1.3.5.2) that catalyzes the oxidation of dihydroorotate to orotate in the pyrimidine biosynthesis pathway. This mitochondrial enzyme, also known as DHOD, DHODase, or DHOdehase, is quinone-dependent and utilizes FMN as a cofactor . Unlike Class-I DHODs (such as URA1), which are soluble and use alternative electron acceptors like fumarate or NAD+, URA9 is a membrane-bound enzyme that couples to the mitochondrial respiratory chain through quinones as its electron acceptor . The complete protein sequence consists of 446 amino acids, with the functional domain spanning residues 14-446 .
URA9 represents a fundamentally different metabolic strategy compared to the URA1 variant found in Saccharomyces cerevisiae. While both catalyze the same reaction in pyrimidine biosynthesis, their electron acceptor preferences and subcellular localization create significant functional differences. URA9, as a Class-II DHODH, is typically mitochondrially targeted and quinone-dependent, which couples pyrimidine synthesis to aerobic respiration in most fungi . In contrast, S. cerevisiae and closely related yeasts possess the cytosolic Class-I DHODH (URA1) that uses fumarate as an electron acceptor, enabling anaerobic pyrimidine synthesis .
This difference creates evolutionary trade-offs: URA9-dependent yeasts traditionally require oxygen for pyrimidine synthesis, while URA1-containing yeasts can synthesize pyrimidines under anaerobic conditions. Interestingly, when genes encoding Class-II DHODs from Lachancea kluyveri (LkURA9) or Schizosaccharomyces pombe (SpURA3) were expressed in S. cerevisiae ura1Δ strains, the resulting strains were only pyrimidine prototrophic under aerobic conditions . This demonstrates the fundamental coupling of typical Class-II DHODH activity to aerobic metabolism.
The L. kluyveri URA9 protein contains structural elements typical of mitochondrially-targeted Class-II DHODs. These include a mitochondrial targeting sequence that directs the protein to the mitochondrial membrane where it can access the quinone pool of the respiratory chain . The protein consists of a large C-terminal α/β barrel domain and a smaller N-terminal helical domain, which is characteristic of Class-II DHODHs .
The protein sequence (ARSVLNSPNFFIGNRAYPLKSSVGAKAILYTAGILGGAFAGYYLFNARSAIHEYLLCPILRLATPDAENGHRAGIFCLKWGLAPKLLFDEDDEVLHVNVFGTKMTNPIGCAAGLDKDAEAIDGIMQGGFGYMEIGSVTPLPQPGNPKPRFFRLPQDDAVINRYGFNSSGHDAVYSNLSKRVTSFLKSYFAKDNEIDKLSLYKNKLLAINLGKNKTGDEVKDYLKGVEKFQSHADVLVINVSSPNTPGLRDLQNESKLTDLLSQIVQKRNSLIQNGNVLGAKTHKPPVLVKIAPDLTEPELESIAVAAKKSKVDGIIVSNTTIQRPDSLVTRDEALKSQTGGLSGKPLKPFALKALKTVYKYTKDSELVLVGCGGISSGQDAIEFAKAGATFVQLYTSYAYKGPGLIAHIKDEVTEELKKEGKTWNQIIGEDSK) reveals conserved binding motifs for FMN and the dihydroorotate substrate, as well as regions that likely interact with quinone acceptors . The membrane association is critical for its function, as it positions the enzyme to transfer electrons from dihydroorotate oxidation to the respiratory chain.
Several expression systems have been successfully employed for producing recombinant URA9, with the choice depending on the experimental goals:
E. coli expression systems: While not specifically documented for L. kluyveri URA9, E. coli systems have been successfully used for other DHODHs, such as human DHODH . For mitochondrial proteins like URA9, expression typically requires removal of the mitochondrial targeting sequence and may involve fusion with solubility-enhancing tags.
Yeast expression systems: Heterologous expression in S. cerevisiae ura1Δ backgrounds has proven particularly useful for functional studies of URA9 orthologs . This approach allows assessment of DHODH activity through complementation of uracil auxotrophy under various conditions. For example, researchers have successfully expressed Class-II DHODH genes from various yeasts in S. cerevisiae ura1Δ strains to study their function under aerobic and anaerobic conditions .
Native expression: Some studies have examined URA9 expression in its native L. kluyveri context, particularly for understanding gene regulation. Microarray analysis has demonstrated that URA9 expression in L. kluyveri is subject to nitrogen catabolite repression and can be induced by specific nitrogen sources .
The choice of expression system should consider whether localization, post-translational modifications, or enzymatic activity is the primary research focus.
Several complementary approaches can be used to measure URA9 enzymatic activity:
Spectrophotometric assays: The most direct approach measures the reduction of electron acceptors during dihydroorotate oxidation. For recombinant human DHODH, activity has been measured by monitoring the reduction of 2,6-dichloroindophenol during oxidation of dihydroorotate . Similar approaches can be adapted for L. kluyveri URA9.
Functional complementation: URA9 activity can be assessed by its ability to complement uracil auxotrophy in DHODH-deficient strains. For example, expression of Ara9, SjURA9, and DbURA9 in S. cerevisiae ura1Δ strains has been used to evaluate their functionality under aerobic and anaerobic conditions .
Oxygen consumption measurements: Since Class-II DHODHs couple to the respiratory chain, oxygen consumption rates in the presence of dihydroorotate can provide an indirect measure of enzyme activity.
Product formation analysis: HPLC or mass spectrometry can be used to directly measure the formation of orotate from dihydroorotate in enzyme reactions.
When designing activity assays, it's important to consider the electron acceptor preferences of URA9, as these can vary even within Class-II DHODHs. For instance, while most Class-II DHODHs use quinones, some variants like ArUra9 from Anaeromyces robustus were found to use free FAD and FMN as electron acceptors instead .
Purification of functional recombinant URA9 requires careful consideration of the protein's membrane association and cofactor requirements:
Tag selection: For recombinant expression, His-tags are commonly used and have been successful for other DHODHs . The tag selection should balance efficient purification with minimal impact on enzyme activity.
Buffer composition: Storage buffers for purified URA9 typically include Tris-based buffers with 50% glycerol to maintain stability . The optimal pH and salt concentration should be determined empirically but typically approximate physiological conditions.
Detergent selection: As a membrane-associated protein, URA9 purification may require detergents. Mild non-ionic detergents like DDM (n-dodecyl β-D-maltoside) are often suitable for maintaining the native conformation and activity of membrane proteins.
Cofactor retention: Ensuring retention of the FMN cofactor during purification is critical for maintaining URA9 activity. Supplementation with FMN during purification steps may be necessary.
Storage conditions: Once purified, URA9 should be stored at -20°C or -80°C for extended storage, with working aliquots kept at 4°C for up to one week . Repeated freeze-thaw cycles should be avoided to prevent activity loss.
Quality control: Purified URA9 can be assessed for quality using SDS-PAGE under reducing and non-reducing conditions, with functional URA9 typically appearing as a band at approximately 41 kDa for the monomeric form .
L. kluyveri URA9 shares fundamental characteristics with other fungal Class-II DHODs but also exhibits species-specific features:
Comparing L. kluyveri URA9 with human DHODH provides valuable insights for drug development:
Structural differences: While both are Class-II DHODs, structural differences exist that can be exploited for selective drug targeting . These differences occur particularly in regions involved in quinone binding and interaction with the respiratory chain.
Inhibitor selectivity: Structural variations between fungal and human DHODs can be leveraged to develop selective inhibitors. For example, drugs targeting human DHODH might not affect fungal URA9 with the same potency, and vice versa, due to these structural differences .
Model for antifungal development: The essential nature of DHODH in fungal pyrimidine synthesis makes it a potential target for antifungal drug development. For instance, the Candida albicans Ura9 protein was identified as essential through modeling predictions, suggesting that drugs like Atovaquone (used for malaria treatment) could potentially target this protein .
Evolutionary conservation: Despite divergence, the catalytic mechanism is conserved between fungal and human DHODs, providing insights into fundamental aspects of DHODH function across evolutionary distances.
Substrate binding: Comparing substrate and inhibitor binding between human and fungal DHODs can reveal critical interactions that determine specificity and potency. This information is valuable for structure-based drug design targeting either enzyme.
Electron acceptor preferences fundamentally shape the metabolic role of DHODs:
L. kluyveri URA9 provides an excellent model system for studying metabolic adaptations to oxygen limitation:
Comparative genomics approach: By comparing URA9 sequences from aerobic-dependent and facultative anaerobic yeasts, researchers can identify specific amino acid substitutions that enable anaerobic functionality. Such studies have already revealed that some yeasts with only Class-II DHODs, like Schizosaccharomyces japonicus and Dekkera bruxellensis, can grow anaerobically .
Heterologous expression studies: Expression of different URA9 orthologs in S. cerevisiae ura1Δ strains allows direct testing of their ability to support growth under aerobic versus anaerobic conditions. This approach has revealed unexpected capabilities of some Class-II DHODs to function anaerobically .
Directed evolution experiments: URA9 can be subjected to directed evolution under anaerobic selection pressure to identify mutations that enhance anaerobic functionality. This approach mimics natural evolutionary processes in an accelerated timeframe.
Structure-function analysis: By introducing specific mutations in URA9 based on comparisons with anaerobically-functional DHODs, researchers can pinpoint critical residues that determine electron acceptor preferences and oxygen dependence.
Metabolic flux analysis: Measuring metabolic fluxes through the pyrimidine pathway under varying oxygen conditions can reveal how URA9 activity affects global metabolic adaptations to hypoxia or anoxia.
Genome-scale metabolic modeling (GEM) offers powerful approaches to understand URA9 function:
Evolutionary analysis of URA9 provides valuable insights into metabolic pathway evolution:
Phylogenetic distribution: The distribution of Class-II DHODs like URA9 versus Class-I DHODs across fungal lineages reveals patterns of gene gain, loss, and replacement. This informs our understanding of how metabolic capabilities evolve in response to environmental pressures.
Horizontal gene transfer: Analysis of URA9 sequences can reveal potential horizontal gene transfer events that might have contributed to metabolic innovations in certain lineages.
Selective pressures: Comparing rates of synonymous and non-synonymous substitutions in URA9 across lineages can identify regions under positive selection, suggesting functional adaptations to different environments.
Co-evolution with respiratory chain components: URA9 function depends on interaction with the respiratory chain. Evolutionary analysis can reveal co-evolution between URA9 and respiratory chain components, providing insights into the evolution of metabolic integration.
Ancestral sequence reconstruction: Reconstructing ancestral URA9 sequences and experimentally testing their properties can reveal the evolutionary trajectory of DHODH function and oxygen dependence.
The study of URA9 variants has already challenged the long-held assumption that Class-I DHODs are required for anaerobic pyrimidine synthesis in eukaryotes. The discovery that some yeasts with only Class-II DHODs can grow anaerobically represents a significant insight into the evolutionary flexibility of metabolic pathways .
Researchers frequently encounter several challenges when working with recombinant URA9:
Protein solubility: As a mitochondrial membrane-associated protein, URA9 can present solubility challenges in recombinant expression systems. This may require optimization of extraction conditions, detergent selection, or expression as truncated versions lacking the membrane-binding regions.
Proper folding: Ensuring proper folding of recombinant URA9 is critical for activity. This may require co-expression of chaperones or optimization of expression conditions (temperature, induction time, etc.).
Cofactor incorporation: URA9 requires FMN as a cofactor for activity. Ensuring proper incorporation of FMN during recombinant expression or supplying it during protein purification is essential for obtaining active enzyme.
Subcellular targeting: When expressing URA9 in heterologous systems, proper subcellular targeting may be inconsistent. For example, GFP-tagged SjUra9 and DbUra9 were localized to S. cerevisiae mitochondria, while ArUra9, whose sequence lacked a mitochondrial targeting sequence, was localized to the yeast cytosol .
Functional assays: Designing appropriate functional assays for URA9 variants with different electron acceptor preferences can be challenging. Each variant may require optimization of assay conditions to accurately measure activity.
Studying URA9 under anaerobic conditions requires careful experimental design:
Strain selection: Using appropriate model organisms is critical. S. cerevisiae ura1Δ strains provide a valuable system for testing the anaerobic functionality of URA9 variants through complementation studies .
Anaerobic chamber setup: Properly controlled anaerobic chambers with continuous monitoring of oxygen levels are essential for reliable results. Trace oxygen can significantly affect URA9 activity and experimental outcomes.
Media composition: Media should be appropriately supplemented for anaerobic growth. For example, sterols and unsaturated fatty acids may need to be added since their biosynthesis requires oxygen.
Appropriate controls: Including appropriate positive controls (e.g., strains expressing S. cerevisiae URA1) and negative controls (e.g., empty vector transformants) is essential for interpreting URA9 functionality under anaerobic conditions.
Adaptive evolution approaches: Some URA9-dependent strains may show delayed anaerobic growth initially but adapt over time. For example, S. cerevisiae strains expressing DbURA9 showed delayed anaerobic growth without pyrimidine supplementation, but adapted faster-growing strains emerged with mutations in FUM1 (fumarase) . This suggests that experimental designs should allow for adaptation periods.
Alternative electron acceptors: When studying URA9 variants with non-conventional electron acceptor preferences, such as ArUra9's use of free FAD and FMN, appropriate electron acceptors should be supplied in the experimental system .
Integrating URA9 studies with broader metabolic analysis provides a more comprehensive understanding:
Multi-omics approaches: Combining URA9 functional studies with transcriptomics, proteomics, and metabolomics can reveal how URA9 activity affects and is affected by global metabolic state. For example, microarray analysis has shown that URC and PYD genes in L. kluyveri are under nitrogen catabolite repression and induced by specific nitrogen sources .
Metabolic flux analysis: Using isotope-labeled precursors to trace carbon and nitrogen flow through metabolic pathways can quantify how URA9 activity affects flux through the pyrimidine pathway and connected metabolic networks.
Synthetic biology approaches: Engineering synthetic pathways that incorporate URA9 variants can test hypotheses about metabolic integration and provide insights into design principles for metabolic engineering.
Computer simulations: Incorporating experimental data on URA9 kinetics into computational models can predict system-level responses to environmental changes and genetic perturbations.
Comparative studies across species: Studying URA9 in multiple species with different metabolic strategies provides evolutionary context for understanding metabolic integration. For instance, comparing URA9 function in obligate aerobes versus facultative anaerobes can reveal principles of metabolic adaptation .
By integrating these approaches, researchers can move beyond studying URA9 in isolation to understand its role in the broader metabolic network and its contribution to organismal fitness in different environments.