Recombinant Lachancea thermotolerans Altered inheritance of mitochondria protein 11 (AIM11)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Lachancea thermotolerans Altered Inheritance of Mitochondria Protein 11 (AIM11)

Lachancea thermotolerans Altered Inheritance of Mitochondria protein 11 (AIM11) is a protein associated with mitochondrial inheritance within the yeast Lachancea thermotolerans . AIM11 is involved in maintaining and transmitting mitochondria, which are essential organelles responsible for cellular energy production . Recombinant AIM11 is produced in a host organism like E. coli and is often used in research to study its function and interactions .

Gene Information

The gene name for Altered Inheritance of Mitochondria protein 11 is AIM11 . Synonyms for AIM11 include KLTH0C06930g and Altered inheritance of mitochondria protein 11 . The UniProt ID for Lachancea thermotolerans AIM11 is C5DE77 .

Protein Properties

Recombinant Lachancea thermotolerans AIM11 is a full-length protein consisting of 150 amino acids . It typically includes an N-terminal His tag for purification purposes . The protein is expressed in E. coli and purified to greater than 90% purity as determined by SDS-PAGE . The molecular weight and exact amino acid sequence can be found in protein databases such as UniProt under the ID C5DE77 .

The amino acid sequence for Recombinant Full Length Lachancea thermotolerans Altered Inheritance Of Mitochondria Protein 11(Aim11) Protein is :
MASVQLSSRDISVFSNEYKERRRLQMMRFFGATAFTLISARLAFRGVQSRKYVPNMFQLN
HKPPTYSFQGEAVSALAFGTGLATGTFSMLVFGTCWVWDISSLAEFTLKMKKLMGEPVTD
QALLENTPMDEDTRKVAEALEDMLKGSRKD

Production and Sourcing

Recombinant Lachancea thermotolerans AIM11 is produced through recombinant DNA technology, where the AIM11 gene is inserted into a plasmid and expressed in E. coli . The expressed protein is then purified using affinity chromatography, often utilizing the His tag . Suppliers such as CUSABIO TECHNOLOGY LLC offer this protein for research purposes .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
AIM11; KLTH0C06930g; Altered inheritance of mitochondria protein 11
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-150
Protein Length
full length protein
Species
Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) (Yeast) (Kluyveromyces thermotolerans)
Target Names
AIM11
Target Protein Sequence
MASVQLSSRDISVFSNEYKERRRLQMMRFFGATAFTLISARLAFRGVQSRKYVPNMFQLN HKPPTYSFQGEAVSALAFGTGLATGTFSMLVFGTCWVWDISSLAEFTLKMKKLMGEPVTD QALLENTPMDEDTRKVAEALEDMLKGSRKD
Uniprot No.

Target Background

Database Links
Protein Families
AIM11 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

How is the mitochondrial genome of Lachancea thermotolerans characterized in terms of evolution and conservation?

The mitochondrial genome of L. thermotolerans displays remarkable conservation across different strains, regardless of geographic origin or ecological niche. Studies have revealed:

  • Extremely low intraspecific divergence rates (π = 0.0014)

  • Minimal variation in intergenic sequences and exceptionally low diversity in coding regions

  • Few rearrangements during species evolution

  • Evidence of strong purifying selection or unusually low mutation rates

These characteristics make L. thermotolerans mitochondrial genomes valuable for evolutionary studies and suggest that this species has undergone significant selective pressure to maintain mitochondrial functionality. Population genomic analyses consistently show that strains from diverse environments maintain highly conserved mitochondrial genomes, indicating essential functional constraints on these cellular components .

What expression systems are commonly used for producing recombinant L. thermotolerans AIM11 protein?

The most common expression system for producing recombinant L. thermotolerans AIM11 protein is Escherichia coli. Key considerations for expression include:

Expression SystemTagProtein FormStorage RecommendationsReconstitution Protocol
E. coliN-terminal His tagLyophilized powder-20°C/-80°C with aliquoting to avoid freeze-thaw cyclesReconstitute in deionized sterile water to 0.1-1.0 mg/mL; add 5-50% glycerol for long-term storage

For optimal results, researchers should:

  • Centrifuge vials briefly before opening

  • Use Tris/PBS-based buffer (pH 8.0) with 6% trehalose for storage

  • Avoid repeated freeze-thaw cycles by preparing working aliquots

  • Store working aliquots at 4°C for no more than one week

What methodologies are most effective for studying the function of AIM11 in mitochondrial inheritance in Lachancea thermotolerans?

Effective methodologies for investigating AIM11 function in L. thermotolerans include:

Genetic Approaches:

  • CRISPR-Cas9 gene editing to create AIM11 knockouts or mutations

  • Complementation assays using wild-type and mutant AIM11 genes

  • Heterologous expression in model organisms like Saccharomyces cerevisiae

Structural and Localization Studies:

  • Fluorescent protein tagging combined with confocal microscopy

  • Immunohistochemistry with anti-AIM11 antibodies

  • Subcellular fractionation followed by Western blotting

Functional Assays:

  • Mitochondrial inheritance tracking using fluorescent mitochondrial markers

  • Measurement of mitochondrial DNA copy number and integrity

  • Assessment of mitochondrial membrane potential and respiratory function

When studying AIM11, it's crucial to consider the cellular responses to environmental conditions, as gene expression in L. thermotolerans is significantly affected by aerobic versus anaerobic conditions. Under anaerobic conditions, cellular wall biogenesis and stabilization genes are activated, which may interact with AIM11 function .

What is the role of AIM11 in response to anaerobic conditions and stress in L. thermotolerans?

Under anaerobic conditions, L. thermotolerans undergoes significant transcriptional reprogramming that likely affects AIM11 function. Research indicates:

  • Anaerobic conditions trigger enrichment of processes related to nutrient uptake, filamentous growth, and iron homeostasis

  • The cellular wall becomes a key focus of gene regulation, with increased biogenesis and stabilization by β-glucan synthesis

  • Mixed cultures under anaerobic conditions cause L. thermotolerans to show increased signals of cell aggregation, cell death, and osmotic and oxidative stresses

  • The main carbon metabolism shifts from glycolysis to the pentose phosphate pathway (PPP), potentially as a protective mechanism against oxidative stress

AIM11 is likely involved in the mitochondrial response to these stress conditions, helping to maintain mitochondrial integrity during respiratory shifts. The protein may play a role in the adaptation of mitochondria to anaerobic conditions, potentially contributing to the altered carbon metabolism observed under stress .

How does the interaction between L. thermotolerans and other yeast species affect mitochondrial function and possibly AIM11 expression?

Interactions between L. thermotolerans and other yeast species create complex ecological relationships that affect metabolism and potentially mitochondrial function. Key observations include:

Biocompatibility and Competition:

  • L. thermotolerans shows strong fermentation capabilities and competitive advantage when co-cultured with species like Hanseniaspora vineae

  • In co-inoculations with Torulaspora delbrueckii, L. thermotolerans maintains higher population counts before declining

  • When cultured with Metschnikowia pulcherrima, a regular decrease in L. thermotolerans population is observed

Metabolic Interactions:

  • Co-inoculation with H. vineae inhibits L. thermotolerans acidification, resulting in reduced lactic acid production (only 0.13 g/L)

  • Synergistic effects can occur with other species, potentially altering metabolic pathways that involve mitochondria

  • Under mixed culture conditions, L. thermotolerans shows upregulation of genes related to phenylalanine metabolism and phenylethanol production

These interactions likely affect mitochondrial function and may alter AIM11 expression as part of the cellular response to competitive stress. Differential cultural media like CHROMagar™ Candida can be used to monitor population dynamics in mixed cultures, providing insights into how these interactions affect L. thermotolerans growth and potentially mitochondrial inheritance patterns .

What are the implications of the highly conserved mitochondrial genome in L. thermotolerans for evolutionary studies?

The remarkable conservation of mitochondrial genomes in L. thermotolerans offers valuable insights for evolutionary studies:

Evolutionary Rate Analysis:

  • The extremely low divergence rate (π = 0.0014) suggests either strong purifying selection or an unusually low mutation rate

  • This conservation persists despite geographic and ecological diversity among strains

  • Mitochondrial genome architecture shows minimal rearrangements during evolution

Phylogenetic Applications:

Domestication and Adaptation:

  • Despite conserved mitochondrial genomes, L. thermotolerans shows adaptations to specific environments, particularly winemaking

  • This suggests that adaptive evolution may occur primarily through nuclear genome changes rather than mitochondrial variations

  • The interplay between nuclear adaptations and conserved mitochondrial functions represents an interesting area for future research

Understanding the mechanisms behind this conservation could provide insights into fundamental aspects of mitochondrial inheritance and the selective pressures that maintain mitochondrial genome integrity across diverse environments.

How can recombinant L. thermotolerans AIM11 protein be optimized for structural studies?

Optimizing recombinant L. thermotolerans AIM11 protein for structural studies requires careful consideration of expression, purification, and stabilization techniques:

Expression Optimization:

  • Use codon-optimized synthetic genes for the expression host (typically E. coli)

  • Test multiple fusion tags beyond His-tag (e.g., MBP, GST, SUMO) to improve solubility

  • Optimize induction conditions (temperature, IPTG concentration, induction time)

  • Consider expression in eukaryotic systems for proper post-translational modifications

Purification Strategy:

  • Implement multi-step purification including affinity chromatography, ion exchange, and size exclusion

  • Use detergents or amphipols for membrane-associated regions of the protein

  • Optimize buffer conditions (pH, salt concentration, additives) based on protein stability

Protein Stability Enhancement:

  • Add stabilizing agents such as glycerol (5-50%) or trehalose (6%)

  • Test various pH conditions within Tris/PBS-based buffers

  • Consider site-directed mutagenesis of flexible regions that might impede crystallization

  • Use thermal shift assays to identify optimal stabilizing conditions

For reconstitution before structural studies, it's recommended to dissolve the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL and add appropriate stabilizing agents. Working aliquots should be prepared to avoid repeated freeze-thaw cycles that could compromise protein integrity .

What differential culture methods can be used to study L. thermotolerans in mixed yeast populations?

When studying L. thermotolerans in mixed populations, appropriate differential culture methods are essential:

CHROMagar™ Candida Method:

  • Provides distinctive colorimetric differentiation of yeast species

  • L. thermotolerans colonies show characteristic color development that changes between day 4 and day 7 of growth

  • Enables accurate counting of mixed populations in co-culture experiments

Population Monitoring Technique:
The following method has proven effective for monitoring L. thermotolerans in mixed cultures:

  • Prepare CHROMagar™ Candida plates according to manufacturer instructions

  • Sample fermentation cultures at regular intervals (typically every 48 hours)

  • Prepare appropriate dilutions to achieve countable plates (30-300 colonies)

  • Incubate plates at 28°C for 4-7 days

  • Count colonies based on characteristic morphology and color development

  • Calculate CFU/mL for each species in the mixed culture

This approach allows researchers to assess competition dynamics and biocompatibility between L. thermotolerans and other yeast species, providing insights into how environmental conditions might affect mitochondrial inheritance and potentially AIM11 function.

What enzymatic activities should be considered when studying the physiological role of AIM11 in L. thermotolerans?

When investigating the physiological context of AIM11 function, researchers should consider the broader enzymatic profile of L. thermotolerans:

Enzymatic ActivityPresence in L. thermotoleransRelevance
Esterase-lipaseConsistently positive in all strainsCore metabolic function
Leucine-AConsistently positive in all strainsCore metabolic function
EsteraseStrain-dependentPotential interaction with membrane dynamics
LipaseStrain-dependentMay affect mitochondrial membrane composition
Valine arylamidaseStrain-dependentProtein metabolism
Cysteine arylamidaseStrain-dependentProtein metabolism
β-glucosidaseStrain-dependentCarbohydrate metabolism
ProteaseRareProtein turnover
PolygalacturonaseRareCell wall modification
GlucanaseRareCell wall modification
XylanaseRarePolysaccharide degradation
CellulaseRarePolysaccharide degradation

This enzymatic variability suggests that AIM11 function should be studied in the context of strain-specific metabolic profiles. The strain-dependent nature of many enzymes indicates that AIM11's role in mitochondrial inheritance may interact with various metabolic pathways differently across strains .

How can transcriptomic approaches enhance our understanding of AIM11 regulation in L. thermotolerans?

Transcriptomic approaches provide valuable insights into AIM11 regulation under various conditions:

RNA-Seq Analysis Strategy:

  • Culture L. thermotolerans under varied conditions:

    • Aerobic vs. anaerobic environments

    • Single culture vs. mixed culture with other yeast species

    • Different carbon sources and nutrient availability

    • Various stress conditions (osmotic, oxidative, temperature)

  • Extract total RNA and perform RNA-Seq analysis:

    • Generate comprehensive transcriptome profiles

    • Identify co-expressed gene networks

    • Map regulatory pathways affecting AIM11 expression

  • Analyze differential expression patterns:

    • Compare AIM11 expression across conditions

    • Identify transcription factors regulating AIM11

    • Determine if AIM11 is part of specific stress response pathways

Research indicates that under anaerobic conditions in mixed cultures, L. thermotolerans shows significant changes in expression profiles related to nutrient uptake, filamentous growth, and stress responses. These conditions also affect carbon metabolism, redirecting it from glycolysis to the pentose phosphate pathway. Understanding how AIM11 expression changes in these contexts can provide insights into its regulatory mechanisms and functional importance .

What are the potential applications of understanding AIM11 function in biotechnology?

Understanding AIM11 function in L. thermotolerans could lead to several biotechnological applications:

Wine Fermentation Optimization:

  • Engineering strains with modified AIM11 expression might enhance stress tolerance during fermentation

  • Improved mitochondrial function could lead to better adaptation to winemaking conditions

  • Understanding AIM11's role in mixed culture dynamics could optimize co-inoculation strategies

Metabolic Engineering:

  • AIM11's potential role in carbon metabolism under stress conditions could be leveraged for designing strains with altered metabolic outputs

  • Enhanced lactic acid production, a key characteristic of L. thermotolerans, might be further optimized through mitochondrial engineering

  • Controlled expression of AIM11 could potentially influence the production of desirable compounds like phenylethanol

Evolutionary Model Systems:

  • The highly conserved nature of mitochondrial genomes in L. thermotolerans makes it an excellent model for studying fundamental aspects of mitochondrial inheritance

  • AIM11 research could provide insights into mechanisms of mitochondrial genome stability applicable to other organisms

  • Understanding the basis for the strong purifying selection observed in L. thermotolerans mitochondrial genomes could reveal new approaches to engineering stable mitochondrial functions

What research gaps remain in our understanding of AIM11 function in L. thermotolerans?

Despite progress in characterizing L. thermotolerans and its mitochondrial genome, several critical knowledge gaps remain regarding AIM11 function:

Structural Characterization:

  • The three-dimensional structure of AIM11 remains unresolved

  • Structure-function relationships need to be established through mutagenesis studies

  • Protein interaction partners have not been comprehensively identified

Regulatory Networks:

  • The transcriptional and post-transcriptional regulation of AIM11 is poorly understood

  • How environmental conditions modulate AIM11 expression and function requires further investigation

  • The integration of AIM11 function with broader cellular stress responses needs clarification

Evolutionary Significance:

  • The reasons behind the strong conservation of mitochondrial genomes in L. thermotolerans remain speculative

  • The selective pressures maintaining AIM11 sequence conservation across strains are not fully characterized

  • How AIM11 function relates to the adaptation of L. thermotolerans to specific ecological niches needs further study

Methodology Development:

  • More efficient genetic manipulation tools for L. thermotolerans would accelerate AIM11 research

  • Improved protein expression and purification protocols specific to AIM11 are needed

  • Advanced imaging techniques to visualize AIM11 localization and dynamics in living cells would enhance functional studies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.