Lachancea thermotolerans Altered Inheritance of Mitochondria protein 11 (AIM11) is a protein associated with mitochondrial inheritance within the yeast Lachancea thermotolerans . AIM11 is involved in maintaining and transmitting mitochondria, which are essential organelles responsible for cellular energy production . Recombinant AIM11 is produced in a host organism like E. coli and is often used in research to study its function and interactions .
The gene name for Altered Inheritance of Mitochondria protein 11 is AIM11 . Synonyms for AIM11 include KLTH0C06930g and Altered inheritance of mitochondria protein 11 . The UniProt ID for Lachancea thermotolerans AIM11 is C5DE77 .
Recombinant Lachancea thermotolerans AIM11 is a full-length protein consisting of 150 amino acids . It typically includes an N-terminal His tag for purification purposes . The protein is expressed in E. coli and purified to greater than 90% purity as determined by SDS-PAGE . The molecular weight and exact amino acid sequence can be found in protein databases such as UniProt under the ID C5DE77 .
The amino acid sequence for Recombinant Full Length Lachancea thermotolerans Altered Inheritance Of Mitochondria Protein 11(Aim11) Protein is :
MASVQLSSRDISVFSNEYKERRRLQMMRFFGATAFTLISARLAFRGVQSRKYVPNMFQLN
HKPPTYSFQGEAVSALAFGTGLATGTFSMLVFGTCWVWDISSLAEFTLKMKKLMGEPVTD
QALLENTPMDEDTRKVAEALEDMLKGSRKD
Recombinant Lachancea thermotolerans AIM11 is produced through recombinant DNA technology, where the AIM11 gene is inserted into a plasmid and expressed in E. coli . The expressed protein is then purified using affinity chromatography, often utilizing the His tag . Suppliers such as CUSABIO TECHNOLOGY LLC offer this protein for research purposes .
KEGG: lth:KLTH0C06930g
The mitochondrial genome of L. thermotolerans displays remarkable conservation across different strains, regardless of geographic origin or ecological niche. Studies have revealed:
Extremely low intraspecific divergence rates (π = 0.0014)
Minimal variation in intergenic sequences and exceptionally low diversity in coding regions
Few rearrangements during species evolution
Evidence of strong purifying selection or unusually low mutation rates
These characteristics make L. thermotolerans mitochondrial genomes valuable for evolutionary studies and suggest that this species has undergone significant selective pressure to maintain mitochondrial functionality. Population genomic analyses consistently show that strains from diverse environments maintain highly conserved mitochondrial genomes, indicating essential functional constraints on these cellular components .
The most common expression system for producing recombinant L. thermotolerans AIM11 protein is Escherichia coli. Key considerations for expression include:
| Expression System | Tag | Protein Form | Storage Recommendations | Reconstitution Protocol |
|---|---|---|---|---|
| E. coli | N-terminal His tag | Lyophilized powder | -20°C/-80°C with aliquoting to avoid freeze-thaw cycles | Reconstitute in deionized sterile water to 0.1-1.0 mg/mL; add 5-50% glycerol for long-term storage |
For optimal results, researchers should:
Centrifuge vials briefly before opening
Use Tris/PBS-based buffer (pH 8.0) with 6% trehalose for storage
Avoid repeated freeze-thaw cycles by preparing working aliquots
Effective methodologies for investigating AIM11 function in L. thermotolerans include:
Genetic Approaches:
CRISPR-Cas9 gene editing to create AIM11 knockouts or mutations
Complementation assays using wild-type and mutant AIM11 genes
Heterologous expression in model organisms like Saccharomyces cerevisiae
Structural and Localization Studies:
Fluorescent protein tagging combined with confocal microscopy
Immunohistochemistry with anti-AIM11 antibodies
Subcellular fractionation followed by Western blotting
Functional Assays:
Mitochondrial inheritance tracking using fluorescent mitochondrial markers
Measurement of mitochondrial DNA copy number and integrity
Assessment of mitochondrial membrane potential and respiratory function
When studying AIM11, it's crucial to consider the cellular responses to environmental conditions, as gene expression in L. thermotolerans is significantly affected by aerobic versus anaerobic conditions. Under anaerobic conditions, cellular wall biogenesis and stabilization genes are activated, which may interact with AIM11 function .
Under anaerobic conditions, L. thermotolerans undergoes significant transcriptional reprogramming that likely affects AIM11 function. Research indicates:
Anaerobic conditions trigger enrichment of processes related to nutrient uptake, filamentous growth, and iron homeostasis
The cellular wall becomes a key focus of gene regulation, with increased biogenesis and stabilization by β-glucan synthesis
Mixed cultures under anaerobic conditions cause L. thermotolerans to show increased signals of cell aggregation, cell death, and osmotic and oxidative stresses
The main carbon metabolism shifts from glycolysis to the pentose phosphate pathway (PPP), potentially as a protective mechanism against oxidative stress
AIM11 is likely involved in the mitochondrial response to these stress conditions, helping to maintain mitochondrial integrity during respiratory shifts. The protein may play a role in the adaptation of mitochondria to anaerobic conditions, potentially contributing to the altered carbon metabolism observed under stress .
Interactions between L. thermotolerans and other yeast species create complex ecological relationships that affect metabolism and potentially mitochondrial function. Key observations include:
Biocompatibility and Competition:
L. thermotolerans shows strong fermentation capabilities and competitive advantage when co-cultured with species like Hanseniaspora vineae
In co-inoculations with Torulaspora delbrueckii, L. thermotolerans maintains higher population counts before declining
When cultured with Metschnikowia pulcherrima, a regular decrease in L. thermotolerans population is observed
Metabolic Interactions:
Co-inoculation with H. vineae inhibits L. thermotolerans acidification, resulting in reduced lactic acid production (only 0.13 g/L)
Synergistic effects can occur with other species, potentially altering metabolic pathways that involve mitochondria
Under mixed culture conditions, L. thermotolerans shows upregulation of genes related to phenylalanine metabolism and phenylethanol production
These interactions likely affect mitochondrial function and may alter AIM11 expression as part of the cellular response to competitive stress. Differential cultural media like CHROMagar™ Candida can be used to monitor population dynamics in mixed cultures, providing insights into how these interactions affect L. thermotolerans growth and potentially mitochondrial inheritance patterns .
The remarkable conservation of mitochondrial genomes in L. thermotolerans offers valuable insights for evolutionary studies:
Evolutionary Rate Analysis:
The extremely low divergence rate (π = 0.0014) suggests either strong purifying selection or an unusually low mutation rate
This conservation persists despite geographic and ecological diversity among strains
Mitochondrial genome architecture shows minimal rearrangements during evolution
Phylogenetic Applications:
Domestication and Adaptation:
Despite conserved mitochondrial genomes, L. thermotolerans shows adaptations to specific environments, particularly winemaking
This suggests that adaptive evolution may occur primarily through nuclear genome changes rather than mitochondrial variations
The interplay between nuclear adaptations and conserved mitochondrial functions represents an interesting area for future research
Understanding the mechanisms behind this conservation could provide insights into fundamental aspects of mitochondrial inheritance and the selective pressures that maintain mitochondrial genome integrity across diverse environments.
Optimizing recombinant L. thermotolerans AIM11 protein for structural studies requires careful consideration of expression, purification, and stabilization techniques:
Expression Optimization:
Use codon-optimized synthetic genes for the expression host (typically E. coli)
Test multiple fusion tags beyond His-tag (e.g., MBP, GST, SUMO) to improve solubility
Optimize induction conditions (temperature, IPTG concentration, induction time)
Consider expression in eukaryotic systems for proper post-translational modifications
Purification Strategy:
Implement multi-step purification including affinity chromatography, ion exchange, and size exclusion
Use detergents or amphipols for membrane-associated regions of the protein
Optimize buffer conditions (pH, salt concentration, additives) based on protein stability
Protein Stability Enhancement:
Add stabilizing agents such as glycerol (5-50%) or trehalose (6%)
Test various pH conditions within Tris/PBS-based buffers
Consider site-directed mutagenesis of flexible regions that might impede crystallization
Use thermal shift assays to identify optimal stabilizing conditions
For reconstitution before structural studies, it's recommended to dissolve the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL and add appropriate stabilizing agents. Working aliquots should be prepared to avoid repeated freeze-thaw cycles that could compromise protein integrity .
When studying L. thermotolerans in mixed populations, appropriate differential culture methods are essential:
CHROMagar™ Candida Method:
Provides distinctive colorimetric differentiation of yeast species
L. thermotolerans colonies show characteristic color development that changes between day 4 and day 7 of growth
Enables accurate counting of mixed populations in co-culture experiments
Population Monitoring Technique:
The following method has proven effective for monitoring L. thermotolerans in mixed cultures:
Prepare CHROMagar™ Candida plates according to manufacturer instructions
Sample fermentation cultures at regular intervals (typically every 48 hours)
Prepare appropriate dilutions to achieve countable plates (30-300 colonies)
Incubate plates at 28°C for 4-7 days
Count colonies based on characteristic morphology and color development
This approach allows researchers to assess competition dynamics and biocompatibility between L. thermotolerans and other yeast species, providing insights into how environmental conditions might affect mitochondrial inheritance and potentially AIM11 function.
When investigating the physiological context of AIM11 function, researchers should consider the broader enzymatic profile of L. thermotolerans:
| Enzymatic Activity | Presence in L. thermotolerans | Relevance |
|---|---|---|
| Esterase-lipase | Consistently positive in all strains | Core metabolic function |
| Leucine-A | Consistently positive in all strains | Core metabolic function |
| Esterase | Strain-dependent | Potential interaction with membrane dynamics |
| Lipase | Strain-dependent | May affect mitochondrial membrane composition |
| Valine arylamidase | Strain-dependent | Protein metabolism |
| Cysteine arylamidase | Strain-dependent | Protein metabolism |
| β-glucosidase | Strain-dependent | Carbohydrate metabolism |
| Protease | Rare | Protein turnover |
| Polygalacturonase | Rare | Cell wall modification |
| Glucanase | Rare | Cell wall modification |
| Xylanase | Rare | Polysaccharide degradation |
| Cellulase | Rare | Polysaccharide degradation |
This enzymatic variability suggests that AIM11 function should be studied in the context of strain-specific metabolic profiles. The strain-dependent nature of many enzymes indicates that AIM11's role in mitochondrial inheritance may interact with various metabolic pathways differently across strains .
Transcriptomic approaches provide valuable insights into AIM11 regulation under various conditions:
RNA-Seq Analysis Strategy:
Culture L. thermotolerans under varied conditions:
Aerobic vs. anaerobic environments
Single culture vs. mixed culture with other yeast species
Different carbon sources and nutrient availability
Various stress conditions (osmotic, oxidative, temperature)
Extract total RNA and perform RNA-Seq analysis:
Generate comprehensive transcriptome profiles
Identify co-expressed gene networks
Map regulatory pathways affecting AIM11 expression
Analyze differential expression patterns:
Compare AIM11 expression across conditions
Identify transcription factors regulating AIM11
Determine if AIM11 is part of specific stress response pathways
Research indicates that under anaerobic conditions in mixed cultures, L. thermotolerans shows significant changes in expression profiles related to nutrient uptake, filamentous growth, and stress responses. These conditions also affect carbon metabolism, redirecting it from glycolysis to the pentose phosphate pathway. Understanding how AIM11 expression changes in these contexts can provide insights into its regulatory mechanisms and functional importance .
Understanding AIM11 function in L. thermotolerans could lead to several biotechnological applications:
Wine Fermentation Optimization:
Engineering strains with modified AIM11 expression might enhance stress tolerance during fermentation
Improved mitochondrial function could lead to better adaptation to winemaking conditions
Understanding AIM11's role in mixed culture dynamics could optimize co-inoculation strategies
Metabolic Engineering:
AIM11's potential role in carbon metabolism under stress conditions could be leveraged for designing strains with altered metabolic outputs
Enhanced lactic acid production, a key characteristic of L. thermotolerans, might be further optimized through mitochondrial engineering
Controlled expression of AIM11 could potentially influence the production of desirable compounds like phenylethanol
Evolutionary Model Systems:
The highly conserved nature of mitochondrial genomes in L. thermotolerans makes it an excellent model for studying fundamental aspects of mitochondrial inheritance
AIM11 research could provide insights into mechanisms of mitochondrial genome stability applicable to other organisms
Understanding the basis for the strong purifying selection observed in L. thermotolerans mitochondrial genomes could reveal new approaches to engineering stable mitochondrial functions
Despite progress in characterizing L. thermotolerans and its mitochondrial genome, several critical knowledge gaps remain regarding AIM11 function:
Structural Characterization:
The three-dimensional structure of AIM11 remains unresolved
Structure-function relationships need to be established through mutagenesis studies
Protein interaction partners have not been comprehensively identified
Regulatory Networks:
The transcriptional and post-transcriptional regulation of AIM11 is poorly understood
How environmental conditions modulate AIM11 expression and function requires further investigation
The integration of AIM11 function with broader cellular stress responses needs clarification
Evolutionary Significance:
The reasons behind the strong conservation of mitochondrial genomes in L. thermotolerans remain speculative
The selective pressures maintaining AIM11 sequence conservation across strains are not fully characterized
How AIM11 function relates to the adaptation of L. thermotolerans to specific ecological niches needs further study
Methodology Development:
More efficient genetic manipulation tools for L. thermotolerans would accelerate AIM11 research
Improved protein expression and purification protocols specific to AIM11 are needed
Advanced imaging techniques to visualize AIM11 localization and dynamics in living cells would enhance functional studies