Recombinant Lachancea thermotolerans Altered inheritance of mitochondria protein 34, mitochondrial (AIM34)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Lachancea thermotolerans Altered Inheritance of Mitochondria Protein 34, Mitochondrial (AIM34)

Recombinant Lachancea thermotolerans Altered Inheritance of Mitochondria Protein 34, Mitochondrial (AIM34) is a protein associated with the mitochondria of the yeast Lachancea thermotolerans . AIM34 is involved in the inheritance and maintenance of mitochondria . Lachancea thermotolerans is a yeast species of interest in winemaking due to its ability to modulate acidity through the production of lactic acid .

Basic Information

CategoryDescription
SpeciesLachancea thermotolerans
SynonymsAIM34; KLTH0C10824g; Altered inheritance of mitochondria protein 34, mitochondrial
UniProt IDC5DEP0
Protein LengthFull Length (41-266aa)
SourceE. coli
TagHis
PurityGreater than 90% as determined by SDS-PAGE
Amino Acid SequenceVHSTPKKDHTTLLSNDKLATFNVMSLKALKNECRTRGLKISGRKGELVDRILAFETSGSLSGGAAKQAARQLHISKSIRARNDIKPVDDVRMPDIAATEKSLETPEQEYIVHITPLSSSADKKPVTRLEKELSVEEVSANVPPAVSTTDHDKVIFQVDAPTDNIEVVDEEAELDADKRASENFGLHATKEELNSRDKTFLFGFAAALVGWWSLKFWDNKGKKRSLT

Function and Significance

Lachancea thermotolerans has gained attention in the wine industry because it can produce wines with improved balance and stability . This yeast's ability to partially convert sugars into lactic acid during alcoholic fermentation contributes to these benefits . The species is related to the fermentative process and is one of the current trends in wine technology research .

AIM34 is likely essential for mitochondrial function, given its role in mitochondrial inheritance . Mitochondria are vital organelles responsible for energy production and various metabolic processes within the cell. Proper mitochondrial inheritance ensures that daughter cells receive functional mitochondria, which is crucial for cellular health and viability.

Genetic Diversity and Adaptation

Lachancea thermotolerans displays intraspecific diversity influenced by ecological niche and geographic location, with the oenological environment playing a significant role . Strains adapted to winemaking environments exhibit specific traits, including increased fitness in the presence of ethanol and sulfites, efficient assimilation of non-fermentable carbon sources, and lower residual fructose levels after fermentation .

Recombinant Production

Recombinant AIM34 protein is produced in E. coli with an N-terminal His tag to facilitate purification . The recombinant protein can be used in research applications to study its structure, function, and interactions with other proteins.

Role in Winemaking

Lachancea thermotolerans's use in winemaking includes:

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, specific format requirements should be indicated during order placement to ensure fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Tag type is determined during production. To prioritize a specific tag, please specify your requirements; we will endeavor to accommodate your request.
Synonyms
AIM34; KLTH0C10824g; Altered inheritance of mitochondria protein 34, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
41-266
Protein Length
full length protein
Species
Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) (Yeast) (Kluyveromyces thermotolerans)
Target Names
AIM34
Target Protein Sequence
VHSTPKKDHTTLLSNDKLATFNVMSLKALKNECRTRGLKISGRKGELVDRILAFETSGSL SGGAAKQAARQLHISKSIRARNDIKPVDDVRMPDIAATEKSLETPEQEYIVHITPLSSSA DKKPVTRLEKELSVEEVSANVPPAVSTTDHDKVIFQVDAPTDNIEVVDEEAELDADKRAS ENFGLHATKEELNSRDKTFLFGFAAALVGWWSLKFWDNKGKKRSLT
Uniprot No.

Target Background

Database Links
Protein Families
AIM34 family
Subcellular Location
Mitochondrion membrane; Single-pass membrane protein.

Q&A

What is Lachancea thermotolerans and why is it significant in mitochondrial research?

Lachancea thermotolerans is a yeast species with unique metabolic characteristics, particularly known for its ability to produce high quantities of lactic acid compared to other yeasts. This non-conventional yeast has gained attention in both ecological and industrial applications due to its unusual biochemical pathways . In mitochondrial research, L. thermotolerans serves as an important model organism for understanding mitochondrial inheritance and biogenesis in non-Saccharomyces yeasts, offering comparative insights into conserved and divergent mechanisms of mitochondrial function across yeast species. The evolution of this yeast has been driven by environmental influences and domestication, leading to distinctive metabolic traits that make it valuable for investigating mitochondrial adaptations .

What are AIM proteins and what is the specific role of AIM34 in mitochondrial function?

AIM (Altered Inheritance of Mitochondria) proteins comprise a family of proteins identified through computational and experimental approaches as critical for proper mitochondrial biogenesis and inheritance. While the search results don't specifically mention AIM34, we can understand its likely function based on other characterized AIM proteins. AIM proteins generally participate in various aspects of mitochondrial function, including protein import, morphology maintenance, and transmission to daughter cells during cell division .

Based on the pattern seen with other AIM proteins like AIM17 and AIM21 (mentioned in the search results), AIM34 likely plays a role in one of these processes. For example, AIM21 (formerly known as YIR003W) was found to be critical for mitochondrial motility despite showing no gross structural defects in mitochondrial morphology . Similarly, AIM34 might have a specialized function that becomes apparent only under specific experimental conditions or genetic backgrounds.

How are genes involved in mitochondrial biogenesis typically identified and characterized?

Identification and characterization of genes involved in mitochondrial biogenesis typically follow a multi-faceted approach:

  • Computational prediction: Algorithms analyze genomic, proteomic, and functional data to predict genes likely involved in mitochondrial processes. This approach identified numerous novel mitochondrial genes as described in the search results .

  • Phenotypic screening: Testing deletion mutants for growth defects on non-fermentable carbon sources (which require functional mitochondria) or using assays such as the "petite frequency" test, which measures the rate at which respiratory-deficient colonies appear .

  • Fluorescence microscopy: Visualizing mitochondrial morphology, distribution, and mobility using mitochondria-targeted fluorescent proteins or immunofluorescence techniques .

  • Double-mutant analysis: Testing for synthetic interactions between candidate genes and known mitochondrial genes to identify functionally redundant components .

In one study, researchers employed a computationally-driven approach that identified 193 candidates for mitochondrial function, of which 109 were confirmed to have roles in mitochondrial biogenesis, representing a 25% increase over previously known participants .

What experimental techniques are used to study mitochondrial inheritance in yeasts?

Several experimental techniques are employed to study mitochondrial inheritance in yeasts:

  • Petite frequency assay: This quantitative approach measures the rate at which respiratory-deficient "petite" colonies form. As described in the search results, this involves:

    • Growing strains in non-fermentable media (e.g., glycerol) to ensure respiratory competence

    • Transferring to fermentable media (e.g., glucose) where respiratory function is optional

    • Using tetrazolium overlay to identify respiratory-deficient colonies (appear white) versus normal colonies (appear red)

  • Dual immunofluorescence: Simultaneous visualization of mitochondria and other cellular structures (e.g., actin cytoskeleton) to examine their relationships during cell division .

  • Mitochondrial mobility tracking: Time-lapse microscopy of GFP-labeled mitochondria to quantify movement patterns and sustained directional motion .

  • Synthetic genetic interaction screening: Systematic creation of double mutants to identify genes with redundant or synergistic functions in mitochondrial inheritance .

What are the known phenotypes associated with mutations in AIM genes?

Mutations in AIM genes typically manifest as specific defects in mitochondrial function or inheritance, though the severity and nature vary by gene. Based on the search results, common phenotypes include:

  • Increased petite frequency: Many AIM gene mutants exhibit elevated rates of respiratory-deficient colony formation. For example, tom71Δ showed a 44% increase in petite frequency despite minimal in vitro defects in translocase activity .

  • Respiratory deficiency: Some mutants are completely unable to grow on non-fermentable carbon sources, indicating severe mitochondrial dysfunction .

  • Motility defects: Deletion of AIM21 (YIR003W) resulted in severe mitochondrial motility defects comparable to puf3Δ strains, despite normal-appearing mitochondrial and actin structures .

  • Synthetic phenotypes: Many AIM genes show synthetic interactions with other mitochondrial genes, suggesting roles in parallel or partially redundant pathways .

Importantly, many of these phenotypes are subtle and would be missed by high-throughput screening approaches, requiring quantitative assays directed by computational predictions .

How can recombinant techniques be applied to study AIM34 function in Lachancea thermotolerans?

To study AIM34 function in Lachancea thermotolerans using recombinant techniques, researchers can employ several advanced approaches:

  • CRISPR-Cas9 gene editing: This can be used to:

    • Create precise deletions or modifications of the AIM34 gene

    • Introduce fluorescent protein tags at the endogenous locus

    • Generate point mutations to study specific protein domains

  • Heterologous expression systems:

    • Express L. thermotolerans AIM34 in model organisms like S. cerevisiae with aim34Δ background to assess functional complementation

    • Express tagged versions for protein localization and interaction studies

  • Promoter replacement strategies:

    • Replace the native AIM34 promoter with regulatable promoters to study the effects of under/overexpression

    • Use inducible systems to study temporal requirements of AIM34 function

  • Fusion protein constructs:

    • Create AIM34-reporter fusions to study protein localization, dynamics, and turnover

    • Implement proximity-dependent labeling techniques (BioID or APEX) to identify proximal interacting proteins

These approaches would need to be optimized for L. thermotolerans, which may require different transformation protocols and selection markers compared to model yeasts.

What is known about the evolutionary conservation of AIM34 across yeast species?

The evolutionary conservation of AIM proteins, including AIM34, follows patterns typical of mitochondrial proteins. While specific information about AIM34 is not provided in the search results, we can make inferences based on patterns observed for other mitochondrial proteins:

Approximately half of the newly characterized mitochondrial proteins identified in yeast studies are conserved in mammals, including several orthologs involved in human disease . This suggests that AIM34 may also have conserved homologs across fungal and possibly mammalian species.

The conservation pattern likely depends on the specific function of AIM34:

  • If involved in core mitochondrial processes (like respiration or protein import), it may be highly conserved

  • If involved in yeast-specific mitochondrial inheritance mechanisms (like actin-dependent transport), conservation might be limited to fungi

Comparative genomic analysis would be required to fully characterize the evolutionary history of AIM34 across species, examining both sequence conservation and synteny patterns.

How does temperature affect the expression and function of mitochondrial inheritance proteins in L. thermotolerans?

Temperature has significant effects on mitochondrial inheritance proteins in L. thermotolerans, which is particularly relevant given this yeast's name ("thermotolerans") reflects its temperature adaptations:

These observations suggest that temperature adaptation in L. thermotolerans involves coordinated changes in multiple cellular systems, including mitochondrial inheritance pathways.

What methodological challenges exist when working with recombinant L. thermotolerans compared to conventional model yeasts?

Working with recombinant L. thermotolerans presents several methodological challenges compared to conventional model yeasts like S. cerevisiae:

  • Transformation efficiency: Non-conventional yeasts typically have lower transformation efficiencies, requiring optimized protocols specific to L. thermotolerans.

  • Genetic tools: Fewer validated genetic tools exist for L. thermotolerans, including:

    • Limited availability of selection markers

    • Fewer characterized promoters and terminators

    • Less extensive plasmid collections

  • Growth conditions: L. thermotolerans has different optimal growth conditions:

    • Different temperature optima (typically growing best around 30°C but able to adapt to higher temperatures through experimental evolution)

    • Unique media requirements or preferences

    • Different stress responses to standard laboratory conditions

  • Genome complexity: The L. thermotolerans genome has:

    • Less extensive annotation compared to model yeasts

    • Fewer characterized genes and genetic elements

    • Potential differences in genetic regulation mechanisms

  • Phenotypic assays: Standard assays may need modification:

    • The tetrazolium overlay petite frequency assay may require optimization

    • Growth assessment on different carbon sources may show different patterns

    • Cell wall differences may affect cellular imaging techniques

Researchers must adapt established protocols to account for these species-specific characteristics.

How do co-evolutionary approaches with bacteria affect mitochondrial protein expression in L. thermotolerans?

Co-evolutionary approaches with bacteria have significant effects on mitochondrial function in L. thermotolerans, as evidenced by the search results:

  • Thermotolerance acquisition: L. thermotolerans strains subjected to sequential exposure to six bacterial species over multiple generations developed improved thermotolerance, growing at 37°C compared to control strains that grew poorly at 35°C .

  • Metabolic shifts: Co-evolved strains exhibited:

    • Elevated fermentative ability

    • Increased productivity

    • Higher ethanol titers per unit volume of substrate consumed

  • Cross-protection mechanisms: Bacteria-exposed strains developed resistance to multiple stressors:

    • High ethanol stress

    • Reactive oxygen species

    • Chemical surfactants

  • Genomic alterations: Pulse field gel electrophoresis (PFGE) analysis revealed molecular changes in the evolved strains , suggesting potential chromosomal rearrangements or other large-scale genomic modifications that could affect mitochondrial protein expression.

This experimental evolution approach represents a unique method for developing thermotolerant yeast strains with enhanced fermentative capabilities, potentially by triggering adaptive changes in mitochondrial function and inheritance mechanisms.

What are the optimal protocols for isolating mitochondria from recombinant L. thermotolerans?

Optimal Protocol for Mitochondrial Isolation from L. thermotolerans:

  • Cell Growth and Harvesting:

    • Culture cells to mid-log phase in appropriate media (YPD for fermentative conditions or YPG for respiratory conditions)

    • For thermotolerant strains, growth at elevated temperatures (up to 37°C for adapted strains) may be required

    • Harvest cells by centrifugation at 3,000 × g for 5 minutes at 4°C

  • Cell Wall Disruption:

    • Pretreat cells with DTT buffer (100 mM Tris-H₂SO₄, pH 9.4, 10 mM dithiothreitol) for 20 minutes at 30°C

    • Enzymatic digestion with zymolyase in sorbitol buffer (1.2 M sorbitol, 20 mM potassium phosphate, pH 7.4) until >80% spheroplast formation

    • For thermotolerant strains, cell wall structure may be modified, potentially requiring adjusted enzyme concentrations

  • Mitochondrial Separation:

    • Lyse spheroplasts using Dounce homogenization in isolation buffer (0.6 M sorbitol, 10 mM Tris-HCl, pH 7.4, 1 mM EDTA, 1 mM PMSF)

    • Differential centrifugation: 1,500 × g to remove cell debris, followed by 12,000 × g to pellet mitochondria

    • Further purification using sucrose gradient ultracentrifugation if higher purity is required

  • Quality Assessment:

    • Respiratory activity measurement using oxygen electrode

    • Western blot for mitochondrial marker proteins

    • Electron microscopy for structural integrity

    • Measurement of contamination from other cellular compartments

This protocol must be optimized specifically for L. thermotolerans, as its cell wall composition and mitochondrial properties may differ from model yeasts.

What techniques are most effective for genetic transformation of L. thermotolerans to study AIM34?

Several transformation techniques can be applied to L. thermotolerans for AIM34 studies, with varying efficiencies:

Transformation MethodEfficiency in L. thermotoleransOptimal ApplicationsKey Considerations
Lithium Acetate/PEGModeratePlasmid transformation Gene deletionsRequires species-specific optimization of incubation times and buffer compositions
ElectroporationHighLinear DNA fragments CRISPR-Cas9 componentsCell wall pretreatment may enhance efficiency Field strength optimization critical
Agrobacterium-mediatedVariableRandom insertional mutagenesisWorks for some non-conventional yeasts May require specific selection conditions
Biolistic transformationLow-moderateMitochondrial transformation Difficult-to-transform strainsExpensive equipment required Useful for organellar transformation

For studying AIM34 specifically, these approaches can be used to:

  • Create AIM34 deletion mutants to study loss-of-function phenotypes

  • Introduce tagged versions of AIM34 for localization and interaction studies

  • Implement CRISPR-Cas9 for precise genome editing of AIM34

  • Develop regulatable expression systems to study dosage effects

Selection markers must be carefully chosen based on the genetic background of the L. thermotolerans strain being used. Common markers include antibiotic resistance genes (kanMX, hphMX, natMX) or complementation of auxotrophic markers if appropriate mutants are available.

What imaging techniques are most suitable for visualizing mitochondrial dynamics in L. thermotolerans?

Visualization of mitochondrial dynamics in L. thermotolerans can be achieved through several complementary techniques:

  • Fluorescence Microscopy Approaches:

    • Mitochondria-targeted fluorescent proteins: Expression of mtGFP, mtRFP, or photoactivatable variants

    • Vital dyes: MitoTracker dyes, TMRE, or JC-1 for membrane potential visualization

    • Immunofluorescence: Using antibodies against mitochondrial proteins like porin

    • Multi-color imaging: Simultaneous visualization of mitochondria and other structures (e.g., actin cytoskeleton using phalloidin)

  • Advanced Microscopy Techniques:

    • Live-cell time-lapse imaging: For tracking mitochondrial movement, as used to study AIM21

    • Super-resolution microscopy: STED or PALM/STORM for sub-organellar details

    • FRAP (Fluorescence Recovery After Photobleaching): To study mitochondrial fusion dynamics

    • FRET imaging: For studying protein-protein interactions within mitochondria

  • Experimental Approaches:

    • Mitochondrial motility assays: Tracking movement every second for defined periods (e.g., two minutes)

    • Definition of sustained movement: Movement in the same direction for at least three consecutive seconds

    • Control experiments: Using metabolic inhibitors (sodium azide, sodium fluoride) to distinguish active transport from passive movement

These techniques can reveal subtle phenotypes in mitochondrial dynamics that might be missed by static imaging alone, as demonstrated in the case of AIM21, which showed normal mitochondrial morphology but severe motility defects .

How can respiratory capacity be accurately measured in recombinant L. thermotolerans strains?

Respiratory capacity of recombinant L. thermotolerans strains can be measured using multiple complementary approaches:

  • Growth-based Assessments:

    • Growth on non-fermentable carbon sources: Measuring growth rates on glycerol, ethanol, or lactate media

    • Petite frequency assay: Quantifying the rate of respiratory-deficient colony formation using tetrazolium overlay techniques

    • Temperature-dependent growth: Comparing growth at various temperatures to assess respiratory robustness

  • Biochemical Measurements:

    • Oxygen consumption rates: Using oxygen electrodes or specialized microplates with oxygen-sensitive fluorophores

    • Enzymatic activity assays: Measuring activities of respiratory chain complexes in isolated mitochondria

    • ATP production capacity: Quantifying ATP synthesis rates linked to respiration

  • Metabolic Analyses:

    • Metabolic flux analysis: Tracing carbon flow through respiratory versus fermentative pathways

    • Ethanol/lactic acid production ratios: Monitoring fermentation products during growth

    • ROS generation: Measuring reactive oxygen species as indicators of respiratory activity or dysfunction

  • Genetic Reporters:

    • Respiratory-responsive promoters: Using GFP or luciferase reporters driven by promoters induced during respiration

    • Redox-sensitive fluorescent proteins: To monitor mitochondrial redox state in living cells

For thermotolerant strains, these measurements should be performed at both standard (30°C) and elevated temperatures (35-37°C) to assess the impact of temperature on respiratory function, as thermotolerant strains show enhanced fermentative capacity at higher temperatures .

What approaches can be used to identify protein-protein interactions involving AIM34 in L. thermotolerans?

Several complementary approaches can identify protein-protein interactions involving AIM34 in L. thermotolerans:

  • Affinity Purification-Mass Spectrometry (AP-MS):

    • Express tagged AIM34 (e.g., TAP-tag, FLAG-tag, HA-tag) in L. thermotolerans

    • Purify AIM34 complexes under native conditions

    • Identify interacting partners by mass spectrometry

    • Compare interaction profiles under different conditions (temperature, carbon source)

  • Proximity-Dependent Labeling:

    • Fuse AIM34 to BioID or APEX2 enzymes

    • Allow in vivo labeling of proteins in proximity to AIM34

    • Purify and identify biotinylated proteins by mass spectrometry

    • Particularly useful for transient or weak interactions in the native cellular environment

  • Yeast Two-Hybrid (Y2H) Screens:

    • Use AIM34 as bait against a L. thermotolerans genomic library or against candidate interactors

    • Employ split-ubiquitin Y2H for membrane-associated interactions

    • Validate interactions using orthogonal methods

  • Fluorescence-Based Interaction Assays:

    • Bimolecular Fluorescence Complementation (BiFC) for in vivo visualization

    • Förster Resonance Energy Transfer (FRET) to study interactions in live cells

    • Fluorescence Cross-Correlation Spectroscopy (FCCS) for dynamic interaction studies

  • Genetic Interaction Mapping:

    • Generate double mutants between aim34Δ and other candidate genes

    • Screen for synthetic phenotypes indicating functional relationships

    • Similar to the approach used for other AIM genes in the search results

For each method, proper controls must be included, and confirmation across multiple techniques is recommended for high-confidence interaction determination.

How should researchers interpret changes in mitochondrial morphology in L. thermotolerans AIM34 mutants?

When interpreting changes in mitochondrial morphology in L. thermotolerans AIM34 mutants, researchers should consider:

  • Morphological Classification Framework:

    • Categorize observed morphologies (tubular, fragmented, aggregated, swollen)

    • Quantify the distribution of different morphological types in population

    • Measure parameters like mitochondrial length, branching, and network connectivity

    • Compare to wild-type under identical conditions

  • Context-Dependent Interpretation:

    • Consider growth conditions (carbon source, temperature, growth phase)

    • Evaluate if morphology changes correlate with functional defects

    • Distinguish primary from secondary effects (e.g., morphology changes due to metabolic alterations)

    • Remember that normal morphology doesn't guarantee normal function (as seen with AIM21)

  • Integration with Functional Data:

    • Correlate morphology with respiratory capacity measurements

    • Assess mitochondrial membrane potential in morphologically distinct mitochondria

    • Examine mitochondrial protein import efficiency

    • Evaluate mitochondrial distribution during cell division

  • Dynamic vs. Static Assessment:

    • Complement static images with time-lapse analysis

    • Measure fusion and fission rates

    • Quantify mitochondrial motility parameters

    • Assess response to metabolic inhibitors to distinguish active from passive processes

Like AIM21, AIM34 mutants might show subtle defects in mitochondrial dynamics despite normal-appearing morphology, necessitating detailed functional analyses beyond static imaging .

What statistical approaches are most appropriate for analyzing mitochondrial inheritance defects in L. thermotolerans?

For analyzing mitochondrial inheritance defects in L. thermotolerans, several statistical approaches are appropriate:

  • For Petite Frequency Analysis:

    • Mann-Whitney U-test: Non-parametric comparison between mutant and wild-type petite frequencies, as used in the studies cited

    • Sample size requirements: At least 12 independent replicates per strain for robust statistical power

    • Multiple testing correction: When screening multiple mutants, apply FDR or Bonferroni correction

  • For Mitochondrial Motility Data:

    • Time-series analysis: Statistical comparison of movement frequencies, distances, and velocities

    • Event counting statistics: Poisson-based models for discrete movement events

    • Comparison to control conditions: Using metabolic inhibitors as negative controls

  • For Growth Assays:

    • Growth curve analysis: Fitting models to extract lag phase, maximum growth rate, and carrying capacity

    • Area under curve (AUC) comparisons: Integrated measure of growth across time points

    • Temperature-dependent growth models: To analyze thermotolerance phenotypes

  • For Microscopy Image Analysis:

    • Object-based image analysis: Quantification of mitochondrial number, size, shape

    • Colocalization statistics: Pearson's correlation or Manders' coefficients for dual-labeling experiments

    • Distribution analysis: Spatial statistics for mitochondrial positioning

  • Experimental Design Considerations:

    • Power analysis: To determine required sample sizes for detecting subtle phenotypes

    • Nested designs: To account for biological and technical variation

    • Paired designs: When comparing isogenic strains or before/after treatments

The appropriate statistical method depends on the specific assay and the nature of the data collected. For subtle phenotypes characteristic of many AIM gene mutants, sensitive assays with adequate replication are essential .

How can researchers distinguish between direct and indirect effects of AIM34 mutation on mitochondrial function?

Distinguishing direct from indirect effects of AIM34 mutation requires a multi-faceted experimental approach:

  • Temporal Analysis:

    • Use inducible expression systems to determine the timeline of phenotypic changes

    • Acute vs. chronic depletion of AIM34 to separate immediate from adaptive effects

    • Time-course studies to establish sequence of molecular events following AIM34 loss

  • Domain-Specific Mutational Analysis:

    • Create point mutations or domain deletions within AIM34

    • Identify which protein regions are responsible for specific phenotypes

    • Perform structure-function analysis to link molecular features to cellular phenotypes

  • Separation of Function Studies:

    • Test if different phenotypes (e.g., mitochondrial motility, respiratory capacity) can be genetically separated

    • Identify specific interaction partners mediating distinct aspects of AIM34 function

    • Determine if expression of interaction partners can suppress specific phenotypes

  • Epistasis Analysis:

    • Create double mutants with genes in related pathways

    • Determine if phenotypes are additive, suppressive, or synergistic

    • Similar to the synthetic interaction approach used for other AIM genes

  • Localization and Timing:

    • Determine precise submitochondrial localization of AIM34

    • Assess if the protein is constitutively present or induced under specific conditions

    • Examine if defects occur in specific stages of the cell cycle or mitochondrial biogenesis

By combining these approaches, researchers can build a comprehensive understanding of AIM34's direct functional roles versus secondary consequences of its absence.

What considerations are important when comparing wild-type and thermotolerant strains of L. thermotolerans?

When comparing wild-type and thermotolerant strains of L. thermotolerans, several key considerations are important:

  • Experimental Design Factors:

    • Growth temperature: Compare strains at both permissive (30°C) and challenging (35-37°C) temperatures

    • Carbon source: Assess growth on both fermentable and non-fermentable carbon sources

    • Growth phase: Compare strains at matched growth phases rather than fixed time points

    • Media composition: Standardize nutrient availability to avoid confounding factors

  • Strain History and Development:

    • Evolution method: Document how thermotolerant strains were developed (e.g., bacterial co-culture evolution)

    • Passage number: Control for potential additional adaptations during laboratory maintenance

    • Genetic background: Ensure comparisons are made in the same genetic background

    • Genome stability: Assess genomic changes using techniques like PFGE

  • Phenotypic Parameters Beyond Temperature:

    • Cross-protection: Test for resistance to multiple stressors (ethanol, ROS, surfactants)

    • Fermentative capacity: Compare product yields and fermentation rates

    • Metabolic flexibility: Assess growth on different carbon sources

    • Mitochondrial parameters: Compare respiratory capacity, mitochondrial morphology, and inheritance

  • Analytical Approaches:

    • Global analyses: Consider transcriptomic, proteomic, or metabolomic comparisons

    • Specific pathway analysis: Focus on known temperature-responsive pathways

    • Mitochondrial function: Compare specific aspects of mitochondrial performance

    • Evolutionary trade-offs: Assess if thermotolerance comes at costs in other phenotypic dimensions

The research described in the search results shows that thermotolerant strains developed through bacterial co-evolution not only grow at higher temperatures but also show enhanced fermentative abilities, suggesting coordinated adaptations across multiple cellular systems .

How can researchers integrate computational predictions with experimental data in studying L. thermotolerans AIM proteins?

Integrating computational predictions with experimental data in studying L. thermotolerans AIM proteins can follow these effective approaches:

  • Computational-Experimental Feedback Loop:

    • Start with computational predictions of gene function

    • Design targeted experiments to test these predictions

    • Use experimental results to refine computational models

    • Iterate to improve both computational predictions and experimental design

This approach proved highly successful in the identification of new mitochondrial biogenesis genes, including AIM proteins, as described in the search results .

  • Recommended Integration Strategy:

Computational ApproachExperimental ValidationIntegration Method
Protein sequence analysisTargeted mutagenesisMap functionally important residues/domains
Protein structure predictionIn vitro biochemical assaysValidate predicted activities or interactions
Gene co-expression networksDouble-mutant analysisConfirm predicted functional relationships
Evolutionary conservationCross-species complementationValidate functional conservation
Protein interaction predictionAffinity purification/Y2HConfirm predicted protein interactions
  • Quantitative Framework Development:

    • Develop quantitative assays that can detect subtle phenotypes, such as the "petite frequency" assay

    • Establish thresholds for significance based on statistical power calculations

    • Compare experimental results against computational confidence scores

    • Use Bayesian approaches to update confidence in computational predictions

  • Comparative Genomic Approaches:

    • Leverage data from model organisms where AIM proteins are better characterized

    • Use evolutionary conservation to prioritize experiments

    • Apply knowledge about AIM protein functions across species

    • Identify L. thermotolerans-specific features for focused investigation

This integrated approach led to the confirmation of 109 of 193 (56%) computationally predicted genes involved in mitochondrial biogenesis, demonstrating the power of directed experimental testing of computational predictions .

What are the most promising future research directions for studying recombinant L. thermotolerans and AIM34?

The most promising future research directions for studying recombinant L. thermotolerans and AIM34 include:

  • Thermotolerance Engineering:

    • Further exploration of bacterial co-evolution approaches to enhance thermotolerance

    • Investigation of the specific role of mitochondrial proteins, including AIM34, in temperature adaptation

    • Development of controlled genetic modifications to improve thermotolerance without bacterial co-evolution

  • Comparative Mitochondrial Biology:

    • Systematic comparison of AIM protein functions across diverse yeast species

    • Investigation of how mitochondrial inheritance mechanisms vary between mesophilic and thermotolerant strains

    • Examination of the evolutionary conservation of AIM34 function across fungal lineages

  • Industrial Applications:

    • Development of thermotolerant L. thermotolerans strains with enhanced lactic acid production for biofermentation

    • Optimization of fermentation conditions for recombinant strains at elevated temperatures

    • Investigation of AIM34's potential role in maintaining mitochondrial function during industrial fermentation processes

  • Advanced Genetic Tool Development:

    • Creation of CRISPR-Cas9 systems optimized for L. thermotolerans

    • Development of inducible expression systems for controlled gene expression

    • Establishment of high-efficiency transformation protocols specific to this yeast

  • Systems Biology Integration:

    • Multi-omics analysis of thermotolerant strains to identify coordinated adaptations

    • Network modeling of mitochondrial function and inheritance in L. thermotolerans

    • Development of predictive models for engineering desired traits in this non-conventional yeast

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.