Recombinant Lachancea thermotolerans Altered inheritance of mitochondria protein 43, mitochondrial (AIM43)

Shipped with Ice Packs
In Stock

Description

General Information

Lachancea thermotolerans is a yeast species gaining traction in winemaking due to its ability to produce lactic acid . L. thermotolerans has undergone significant evolution and domestication, leading to distinct metabolic traits . One notable protein within this yeast is the "Altered inheritance of mitochondria protein 43, mitochondrial (AIM43)", which also goes by the names FMP14 or KLTH0E13398g . AIM43 is involved in mitochondrial function .

Basic Properties

Recombinant AIM43 is produced using genetic engineering techniques . It is often expressed in E. coli with a His-tag for purification purposes .

PropertyDescription
Product OverviewRecombinant Full Length Lachancea thermotolerans Altered inheritance of mitochondria protein 43, mitochondrial(AIM43) Protein (C5DIL2) (23-161aa), fused to N-terminal His tag, was expressed in E. coli .
Gene NamesAIM43; KLTH0E13398g; FMP14
SpeciesLachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)
Uniprot No.C5DIL2
Expression Region23-161
AA SequenceSTSIKSLEDLAKLKSLDDVDPDLVRKLINERTNELNSQAELAMLKQMQSQENQQQQQALK KFVRPMWIFLLMSSFFYLTGHYIWWKLEYDEREIELHKQVQALRQELDSAIAAKHSGKEPALSGAGAKKPKRWYLAWLW

Role in Lachancea thermotolerans

AIM43 is a protein found in the mitochondria of Lachancea thermotolerans . Mitochondria are essential organelles responsible for energy production and various metabolic processes within the cell . AIM43 likely plays a role in maintaining mitochondrial function and integrity . The specific function of AIM43 is related to the inheritance of mitochondria .

Lachancea thermotolerans in Winemaking

Lachancea thermotolerans has become increasingly important in the wine industry .

  • Lactic Acid Production: L. thermotolerans produces high quantities of lactic acid, which can be beneficial in winemaking, particularly for balancing acidity in wines .

  • Adaptation to Winemaking: Certain strains of L. thermotolerans have adapted to the winemaking environment, showing increased fitness in the presence of ethanol and sulphites .

  • Genomic Diversity: Population genomic analysis reveals significant genetic diversity within L. thermotolerans, with specific groups showing adaptations to different environments .

  • Sour Beer Production: L. thermotolerans can be used for the production of sour beer .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
INA17; KLTH0E13398g; Inner membrane assembly complex subunit 17
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
23-161
Protein Length
Full Length of Mature Protein
Species
Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) (Yeast) (Kluyveromyces thermotolerans)
Target Names
INA17
Target Protein Sequence
STSIKSLEDLAKLKSLDDVDPDLVRKLINERTNELNSQAELAMLKQMQSQENQQQQQALK KFVRPMWIFLLMSSFFYLTGHYIWWKLEYDEREIELHKQVQALRQELDSAIAAKHSGKEP ALSGAGAKKPKRWYLAWLW
Uniprot No.

Target Background

Function

AIM43 (Altered Inheritance of Mitochondria protein 43) is a component of the mitochondrial INAC (INA complex). It plays a vital role in mitochondrial F1F0-ATP synthase biogenesis. Specifically, INAC facilitates the assembly of the peripheral stalk and promotes the integration of the catalytic F1-domain with the membrane-embedded F0-domain.

Database Links
Protein Families
INA17 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What are the optimal conditions for expressing recombinant L. thermotolerans AIM43 protein?

For optimal expression of recombinant AIM43:

  • Expression System: E. coli is the recommended heterologous expression system for this protein .

  • Construct Design: The protein is typically expressed with an N-terminal His-tag fusion for purification purposes, with the mature sequence spanning amino acids 23-161 .

  • Buffer Conditions: Optimal storage includes Tris/PBS-based buffer with 6% trehalose, pH 8.0 .

  • Reconstitution Protocol:

    • Centrifuge vial briefly before opening

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add 5-50% glycerol (final concentration) for long-term storage

    • Default final glycerol concentration is typically 50%

How should researchers store and handle recombinant AIM43 to maintain stability?

For optimal stability and activity:

  • Store at -20°C/-80°C upon receipt

  • Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

  • For reconstituted protein, addition of 50% glycerol is recommended for long-term storage

  • Repeated freezing and thawing is not recommended as it may affect protein structure and function

What analytical methods are appropriate for studying AIM43 protein structure and function?

Several complementary approaches are recommended:

  • Structural Analysis:

    • Circular dichroism (CD) spectroscopy to determine secondary structure elements

    • X-ray crystallography or cryo-EM for high-resolution structure determination

    • NMR spectroscopy for dynamic structural information

  • Functional Characterization:

    • Mitochondrial localization confirmation using fluorescence microscopy with GFP-tagged constructs

    • Co-immunoprecipitation assays to identify interacting partners

    • Blue Native PAGE to examine integration into mitochondrial protein complexes

  • Expression Analysis:

    • RT-qPCR to quantify gene expression under different conditions

    • Western blotting with anti-His antibodies for recombinant protein detection

    • Mass spectrometry for protein identification and post-translational modifications

How can researchers assess the purity and functional integrity of recombinant AIM43?

Researchers should employ multiple quality control methods:

  • Purity Assessment:

    • SDS-PAGE analysis (expected purity >90%)

    • Size exclusion chromatography to confirm homogeneity

    • Mass spectrometry to verify molecular weight and sequence integrity

  • Functional Integrity:

    • Circular dichroism to confirm proper protein folding

    • Thermal shift assays to evaluate protein stability

    • Activity assays based on predicted function (mitochondrial import assays, if appropriate)

  • Contamination Testing:

    • Endotoxin testing for E. coli-expressed proteins

    • Host cell protein (HCP) ELISA to detect residual E. coli proteins

How does AIM43 from L. thermotolerans compare to homologous proteins in other yeast species?

AIM43 belongs to a family of mitochondrial proteins found across various yeast species:

SpeciesProtein NameUniProt IDProtein LengthSimilarity to L. thermotolerans AIM43
Lachancea thermotoleransAIM43C5DIL2139 aa (mature)100%
Ashbya gossypiiAIM43Q75D33141 aa (mature)Moderate similarity, conserved functional domains
Saccharomyces cerevisiaeAIM-related proteinsVariousVariableFunctional conservation rather than sequence conservation

The presence of AIM43 homologs across different yeast species suggests evolutionary conservation of mitochondrial inheritance mechanisms . Comparative sequence analysis can provide insights into functionally important regions and species-specific adaptations.

What is known about the function of AIM proteins in yeast mitochondrial biology?

AIM (Altered Inheritance of Mitochondria) proteins represent a functionally diverse group involved in various aspects of mitochondrial biology:

  • Mitochondrial Inheritance: Key roles in proper distribution of mitochondria during cell division

  • Mitochondrial Morphology: Maintenance of mitochondrial structure and organization

  • Protein Import: Several AIM proteins participate in mitochondrial protein import pathways

  • Respiratory Function: Many AIM proteins are required for optimal respiratory metabolism

The specific function of AIM43 is not extensively characterized in the literature, but based on its classification, it likely participates in pathways governing mitochondrial inheritance patterns in L. thermotolerans .

How can researchers investigate the role of AIM43 in mitochondrial inheritance using genetic approaches?

Several genetic strategies can be employed:

  • Gene Knockout/Knockdown:

    • CRISPR-Cas9 gene editing to create AIM43 deletion mutants

    • RNA interference (if applicable in L. thermotolerans) to reduce expression

    • Analysis of mitochondrial distribution and inheritance patterns in knockout cells

  • Complementation Studies:

    • Expression of AIM43 in knockout strains to confirm phenotype rescue

    • Cross-species complementation with homologs to assess functional conservation

  • Site-Directed Mutagenesis:

    • Targeted mutation of conserved residues to identify functional domains

    • Creation of chimeric proteins between AIM43 and homologs to determine domain-specific functions

  • Reporter Systems:

    • Fusion with fluorescent proteins for localization studies

    • Split-GFP or FRET-based approaches for interaction studies with potential partners

What are the implications of studying AIM43 for understanding L. thermotolerans biotechnological applications?

L. thermotolerans has significant biotechnological potential, particularly in winemaking:

  • Metabolic Engineering Context:

    • Understanding mitochondrial function may provide insights into L. thermotolerans' distinctive metabolic characteristics

    • AIM43's role may relate to the unique ability of L. thermotolerans to produce lactic acid and reduce ethanol content

  • Stress Response Mechanisms:

    • Mitochondrial proteins often play crucial roles in stress adaptation

    • L. thermotolerans shows remarkable adaptation to various environmental conditions, possibly mediated through mitochondrial pathways

  • Evolutionary Perspective:

    • The species has evolved unique traits driven by geographical determination and anthropisation

    • AIM43 may contribute to adaptations that make L. thermotolerans suitable for specific biotechnological applications

What experimental controls should be included when studying recombinant AIM43 function?

A robust experimental design should include:

  • Positive Controls:

    • Known functional mitochondrial proteins with similar characteristics

    • Previously characterized AIM proteins from related species

  • Negative Controls:

    • Empty vector controls for expression studies

    • Heat-denatured protein for functional assays

    • Non-mitochondrial proteins of similar size/structure

  • Technical Controls:

    • His-tag only protein to control for tag effects

    • Multiple independent protein preparations to ensure reproducibility

    • Concentration-dependent assays to establish dose-response relationships

How can researchers address potential discrepancies between in vitro and in vivo studies of AIM43?

To reconcile potential differences between in vitro biochemical studies and in vivo functional analyses:

  • Comparative Approaches:

    • Perform parallel in vitro and in vivo experiments under comparable conditions

    • Use cell-free systems that mimic physiological environments

  • Validation Strategies:

    • Confirm in vitro observations with corresponding in vivo phenotypes

    • Use complementary techniques to verify key findings

  • Physiological Relevance:

    • Design in vitro experiments that reflect in vivo conditions (pH, ion concentrations, temperature)

    • Consider the influence of other cellular components that may be absent in purified systems

  • Reconstitution Experiments:

    • Progressively add complexity to in vitro systems to approach in vivo conditions

    • Use liposome reconstitution to study membrane protein functions

What are promising research avenues for elucidating AIM43's molecular mechanisms?

Several promising approaches could advance understanding of AIM43:

  • Structural Biology:

    • High-resolution structure determination to identify functional domains

    • Molecular dynamics simulations to predict protein-protein interactions

  • Systems Biology:

    • Proteome-wide interaction studies to place AIM43 in the context of mitochondrial networks

    • Transcriptomic analysis under various conditions to identify co-regulated genes

  • Evolutionary Studies:

    • Phylogenetic analysis across diverse yeast species to understand evolutionary constraints

    • Investigation of AIM43 variation in natural L. thermotolerans populations

  • Advanced Imaging:

    • Super-resolution microscopy to visualize mitochondrial localization and dynamics

    • Live-cell imaging to track mitochondrial inheritance patterns in real-time

How might understanding AIM43 function contribute to broader knowledge of eukaryotic mitochondrial biology?

Research on AIM43 has potential to impact several areas:

  • Fundamental Mitochondrial Biology:

    • Insights into mechanisms governing mitochondrial inheritance across eukaryotes

    • Understanding of mitochondrial protein import and membrane organization

  • Evolutionary Cell Biology:

    • Comparative analysis could reveal conserved and divergent aspects of mitochondrial inheritance

    • Insights into how mitochondrial function has evolved in different yeast lineages

  • Biotechnological Applications:

    • Potential for engineering mitochondrial function in L. thermotolerans to enhance desired traits

    • Applications in metabolic engineering and synthetic biology approaches

  • Disease Relevance:

    • While focused on yeast, discoveries may have parallels to mitochondrial inheritance disorders in humans

    • Foundational knowledge for understanding mitochondrial dynamics in health and disease

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.