Recombinant Lachancea thermotolerans Genetic interactor of prohibitin 7, mitochondrial (GEP7)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
GEP7; KLTH0H06754g; Genetic interactor of prohibitin 7, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
22-302
Protein Length
Full Length of Mature Protein
Species
Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) (Yeast) (Kluyveromyces thermotolerans)
Target Names
GEP7
Target Protein Sequence
ASQSRSPPRSLLQRQAKRRGEAEAVAPSQLIVTSLKDIFSTFQPSGFTQEDDELEAVKQR EDAMQRLENGELRELLLHKFGARRIPSTTETGNSVGDLRIPPRNINQAFHNLTTQERELI EVFQSLGTPSMNWRDVPLVSKQLQFYISFGSYGPREGITFLGSKPEDFIWSKTSRRLLPG QTVRKLPKDATTNTWTCIPSRKANFERMKKGLDPGTRIIAWLGILIVMIASVRDYKQRRD SEATVKVSEFTEQETSEPQAAQQDTAPISKTPKSWYQFWKS
Uniprot No.

Target Background

Function
Plays a role in respiratory growth and is essential for cell survival in the absence of prohibitins.
Database Links
Protein Families
GEP7 family
Subcellular Location
Mitochondrion membrane; Single-pass membrane protein.

Q&A

What is the GEP7 protein in Lachancea thermotolerans and how does it compare to its homologs in other yeasts?

The Genetic interactor of prohibitin 7, mitochondrial (GEP7) in Lachancea thermotolerans is a mitochondrial protein that interacts with prohibitins, which are evolutionarily conserved proteins that form complexes in the mitochondrial inner membrane. The mature GEP7 protein in L. thermotolerans consists of 281 amino acids (position 22-302) with UniProt ID C5E2Q0 .

Comparative analysis with its homolog in Saccharomyces cerevisiae (YGL057C) reveals similar functional characteristics - both are associated with mitochondrial function and interact with prohibitins. In S. cerevisiae, GEP7 is described as a "protein of unknown function" where null mutants exhibit respiratory growth defects and synthetic interactions with prohibitin (phb1) and gem1 . This suggests evolutionary conservation of GEP7's role in mitochondrial function across yeast species.

While structural homology exists between these proteins, L. thermotolerans has evolved distinct thermotolerance capabilities that may influence GEP7's function under thermal stress conditions . Unlike S. cerevisiae, L. thermotolerans diverged prior to the whole genome duplication event, which may have implications for the evolutionary adaptations of GEP7 in these different yeast lineages .

What are the optimal protocols for expression and purification of recombinant L. thermotolerans GEP7 protein?

Expression System Selection:
The optimal expression system for recombinant L. thermotolerans GEP7 is Escherichia coli . When designing expression constructs, researchers should consider:

  • Codon optimization for E. coli expression

  • Addition of an N-terminal His-tag for affinity purification

  • Inclusion of appropriate protease cleavage sites if tag removal is desired

  • Expression of the mature protein (residues 22-302) rather than the full-length protein to avoid improper processing

Purification Protocol:

  • Cell Lysis: Perform in a buffer containing mild detergents suitable for membrane proteins

  • Initial Purification: Utilize Ni-NTA affinity chromatography with imidazole gradient elution

  • Secondary Purification: Employ size exclusion chromatography to separate the properly folded protein from aggregates

  • Quality Control: Verify purity by SDS-PAGE (>90% purity should be targeted)

  • Storage Conditions: Store in Tris/PBS-based buffer with 6% Trehalose at pH 8.0

  • Storage Recommendations: Aliquot and store at -80°C; avoid repeated freeze-thaw cycles as they significantly reduce protein activity

To verify proper folding and function, researchers should perform:

  • Blue native electrophoresis to assess complex formation

  • Circular dichroism to evaluate secondary structure

  • Functional assays to assess interaction with prohibitin complexes

What analytical techniques are most effective for studying GEP7-prohibitin interactions in mitochondrial membranes?

Based on methodologies used for studying similar prohibitin complexes, the following analytical approaches are recommended:

1. Blue Native Electrophoresis (BNE):
This technique has proven particularly effective for analyzing prohibitin complexes and their interactions with other proteins . For GEP7-prohibitin interactions:

  • Solubilize mitochondrial membranes using mild detergents (digitonin at 1-2% concentration)

  • Separate complexes under native conditions

  • Identify individual components through second-dimension SDS-PAGE

  • Confirm protein identity using western blotting or mass spectrometry

2. Mass Spectrometry-Based Approaches:

  • Crosslinking Mass Spectrometry (XL-MS) to identify interaction interfaces

  • Protein correlation profiling to confirm co-migration in native separation techniques

  • MALDI-TOF MS for protein identification (as was done for prohibitins, achieving 77.7% sequence coverage for Phb1p and 53.6% for Phb2p)

3. Co-Immunoprecipitation:
For validating direct interactions between GEP7 and prohibitins:

  • Generate antibodies against GEP7 or use tagged versions

  • Perform reciprocal co-IP experiments

  • Include appropriate controls (isotype control antibodies, prohibitin-null mutants)

4. Yeast Two-Hybrid Analysis:
For mapping specific interaction domains:

  • Use membrane yeast two-hybrid system variants suitable for membrane proteins

  • Create truncation mutants to map interaction domains

5. Microscopy-Based Approaches:

  • Fluorescence Resonance Energy Transfer (FRET) to visualize interactions in intact mitochondria

  • Super-resolution microscopy to localize prohibitin-GEP7 complexes within mitochondrial subcompartments

These methodologies can be combined to provide comprehensive characterization of GEP7-prohibitin interactions at molecular, subcellular, and functional levels.

What is the role of GEP7 in thermotolerance of Lachancea thermotolerans?

The role of GEP7 in thermotolerance appears to be linked to mitochondrial function and membrane stability under thermal stress conditions. Evidence suggests several potential mechanisms:

Mitochondrial Membrane Stability:
GEP7, through its interaction with prohibitins, likely contributes to the stabilization of the mitochondrial inner membrane under thermal stress. Prohibitins are known to form a membrane-bound chaperone complex that stabilizes mitochondrial proteins . This function becomes particularly critical under elevated temperature conditions where membrane fluidity and protein stability are compromised.

Respiratory Function Maintenance:
The respiratory defect observed in GEP7-null mutants in S. cerevisiae suggests a role in maintaining respiratory chain integrity. L. thermotolerans strains can grow at temperatures up to 37°C (compared to mesophilic yeasts that typically grow optimally at 30°C) , and this thermotolerance may be partly attributed to the ability to maintain respiratory function at elevated temperatures.

Connection to Prohibitin Complex:
Research data indicates that prohibitins act as a "membrane-bound chaperone for the stabilization" of proteins . Given GEP7's interaction with prohibitins, it likely participates in this chaperone function, potentially contributing to:

  • Protection of membrane proteins from thermal denaturation

  • Maintenance of mitochondrial membrane integrity during heat stress

  • Stabilization of respiratory chain complexes

Evolutionary Perspective:
L. thermotolerans isolates show variable thermotolerance abilities , suggesting that strain-specific adaptations in proteins like GEP7 may contribute to differential thermal tolerance. The experimental evolution of L. thermotolerans strains capable of growth at 37°C (compared to ancestral strains limited to 35°C) may involve adaptations in GEP7-prohibitin interactions.

How does recombinant GEP7 protein contribute to understanding mitochondrial membrane protein complexes?

Recombinant GEP7 protein serves as a valuable tool for elucidating the organization and function of mitochondrial membrane protein complexes, particularly in the context of prohibitin complexes. Its contributions include:

1. Structural Insights into Prohibitin Complexes:

  • Reconstitution experiments with recombinant GEP7 and prohibitins can reveal assembly mechanisms of these large complexes

  • Structure-function relationships can be established through site-directed mutagenesis of key residues

  • Comparison with homologous proteins from different yeast species provides evolutionary insights

2. Mechanistic Understanding of Membrane-Bound Chaperones:
Prohibitins function as membrane-bound chaperones that stabilize mitochondrial proteins . GEP7's interaction with this complex provides a model system to study:

  • How membrane-bound chaperones recognize their substrate proteins

  • The mechanisms of protein stabilization within membrane environments

  • The role of accessory proteins (like GEP7) in modulating chaperone activity

3. Insights into Mitochondrial Quality Control:
The prohibitin complex has been implicated in mitochondrial quality control processes. Recombinant GEP7 can be used to study:

  • Protein degradation pathways in mitochondria

  • Regulation of mitochondrial proteases

  • Protein homeostasis under stress conditions

4. Comparative Analysis Across Species:

  • Comparative studies between L. thermotolerans GEP7 and its homologs in other yeast species (particularly S. cerevisiae) can reveal adaptations related to thermotolerance

  • The functional divergence between homologs can illuminate evolutionary adaptations in mitochondrial membrane complexes

5. Technological Applications:
Understanding GEP7-prohibitin interactions contributes to the development of:

  • Improved yeast strains for high-temperature fermentation processes

  • Novel approaches for engineering thermotolerance in industrial microorganisms

  • Potential therapeutic targets for mitochondrial disorders

How can the synthetic interaction between GEP7 and prohibitins be leveraged to enhance thermotolerance in industrial yeast strains?

The synthetic interaction between GEP7 and prohibitins presents several strategic opportunities for enhancing thermotolerance in industrial yeast strains:

Rational Engineering Approaches:

  • Co-expression Optimization: Based on findings that prohibitins form a complex that increases in abundance upon co-overexpression , a coordinated expression strategy for GEP7 and prohibitins (PHB1/PHB2) could be implemented:

    • Design expression cassettes with optimized promoter strengths

    • Balance expression levels to avoid aggregation or misfolding

    • Consider chromosomal integration at multiple loci for stable expression

  • Protein Engineering:

    • Create chimeric proteins combining thermostable domains from L. thermotolerans GEP7 with functional domains from industrial yeast homologs

    • Introduce specific mutations identified through comparative analyses of thermotolerant and mesophilic strains

    • Design stabilized versions of the prohibitin-GEP7 complex through protein interface engineering

Evolutionary Engineering Strategies:

  • Directed Evolution under Thermal Selection:
    The successful evolution of thermotolerant L. thermotolerans through bacterial co-culture suggests alternative approaches:

    • Implement similar bacterial co-culture strategies with industrial strains

    • Design synthetic microbial communities that promote thermotolerance evolution

    • Combine adaptive laboratory evolution with targeted overexpression of GEP7 and prohibitins

  • Hybrid Strain Development:

    • Create hybrids between L. thermotolerans and industrial Saccharomyces strains

    • Use genome shuffling approaches to combine beneficial alleles

    • Apply CRISPR-based genome editing to introduce thermotolerant alleles of GEP7 and prohibitins

Functional Validation Strategy:

ApproachMethodologyExpected OutcomeValidation Metrics
GEP7-PHB co-expressionPlasmid-based or genomic integrationEnhanced thermotoleranceGrowth rate at elevated temperatures; Fermentation performance at 35-40°C
Directed evolutionSequential batch culture with temperature rampingAdapted strains with improved thermal toleranceComparative proteomics of mitochondrial membrane; Respiratory capacity at high temperatures
Chimeric protein engineeringDomain swapping between thermotolerant and mesophilic homologsOptimized protein complexesComplex stability assessment; Mitochondrial membrane integrity at high temperatures
Genomic integrationCRISPR-Cas9 based allele replacementStable expression of optimized variantsLong-term stability; Industrial process simulation

The ultimate validation should include assessment under actual industrial fermentation conditions, measuring ethanol production efficiency at elevated temperatures (35-37°C) compared to standard conditions (30°C) .

What is the molecular mechanism by which the GEP7-prohibitin complex stabilizes mitochondrial proteins under thermal stress?

The molecular mechanism of protein stabilization by the GEP7-prohibitin complex under thermal stress likely involves several coordinated functions:

1. Membrane Scaffolding Function:
Prohibitins form large ring-shaped complexes in the mitochondrial inner membrane that act as organizational scaffolds . The GEP7-prohibitin interaction likely contributes to:

  • Maintenance of membrane domains with optimal lipid composition during thermal stress

  • Organization of respiratory chain complexes to prevent stress-induced disaggregation

  • Creation of protected membrane microenvironments with reduced fluidity at elevated temperatures

2. Direct Chaperone Activity:
Evidence suggests prohibitins function as membrane-bound chaperones that directly interact with client proteins :

  • The prohibitin complex likely recognizes partially unfolded membrane proteins through exposed hydrophobic regions

  • GEP7 may modulate substrate specificity or enhance chaperone activity

  • The complex appears to function as a "holdase" rather than an ATP-dependent foldase, preventing aggregation until proper folding can occur

3. Regulation of Mitochondrial Proteases:
Studies in S. cerevisiae suggest prohibitins negatively regulate mitochondrial proteases :

  • The GEP7-prohibitin complex may shield susceptible proteins from stress-induced degradation

  • This protection would be particularly important during thermal stress when proteins are partially unfolded

  • The complex may modulate the activity of the m-AAA protease (Afg3p/Rca1p complex) that otherwise might degrade essential mitochondrial proteins

4. Stabilization of Mitochondrial Translation Products:
Experimental evidence indicates that prohibitins stabilize mitochondrial translation products :

  • The complex likely binds newly synthesized mitochondrially-encoded proteins

  • This binding prevents premature degradation during thermal stress

  • GEP7 may facilitate the interaction between prohibitins and specific mitochondrial translation products

5. Functional Model:
The experimental data supports a model where:

  • Thermal stress causes partial unfolding of mitochondrial membrane proteins

  • The GEP7-prohibitin complex recognizes these partially unfolded proteins

  • Direct binding prevents aggregation and premature degradation

  • The complex maintains proteins in a competent state until proper folding can occur

  • This stabilization maintains mitochondrial function at elevated temperatures

This mechanism explains why L. thermotolerans strains can maintain respiratory function at temperatures up to 37°C , while strains lacking functional GEP7-prohibitin interactions would exhibit respiratory defects at elevated temperatures.

What are the most promising strategies for structural characterization of the GEP7-prohibitin complex?

The structural characterization of the GEP7-prohibitin complex presents significant challenges due to its membrane-associated nature, but several cutting-edge approaches offer promising avenues:

1. Cryo-Electron Microscopy (cryo-EM):
Cryo-EM has revolutionized membrane protein structural biology and offers several advantages:

2. Integrative Structural Biology Approaches:
Combining multiple experimental techniques:

  • Crosslinking Mass Spectrometry (XL-MS) to map interaction interfaces

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS) to identify dynamic regions

  • Small-Angle X-ray Scattering (SAXS) for low-resolution envelope information

  • Computational integration of these data sets to generate structural models

3. Advanced NMR Approaches:

  • Solid-state NMR for membrane-embedded regions

  • Solution NMR for soluble domains

  • Selective isotopic labeling strategies to focus on interaction interfaces

  • Paramagnetic relaxation enhancement to map distances between components

4. Computational Approaches:
Recent advances in protein structure prediction can complement experimental approaches:

  • AlphaFold2 and RoseTTAFold prediction of individual components

  • Molecular docking guided by experimental constraints

  • Molecular dynamics simulations to study complex dynamics in membrane environments

5. Methodological Workflow:

The most promising initial approach would combine recombinant expression of components, reconstitution into nanodiscs, and cryo-EM analysis, supported by crosslinking mass spectrometry to identify interaction interfaces.

How does the evolutionary divergence between Lachancea thermotolerans and Saccharomyces cerevisiae influence the functional adaptation of the GEP7-prohibitin complex?

The evolutionary divergence between Lachancea thermotolerans and Saccharomyces cerevisiae provides a fascinating natural experiment for understanding the functional adaptation of the GEP7-prohibitin complex:

Evolutionary Context:
L. thermotolerans diverged from the S. cerevisiae lineage prior to the whole genome duplication event , which has significant implications for protein function and adaptation:

  • Post-Duplication Subfunctionalization: In S. cerevisiae, gene duplication may have allowed specialization of prohibitin-interacting proteins

  • Pre-Duplication Functional Constraints: In L. thermotolerans, GEP7 likely maintains broader functional roles due to the absence of redundant paralogs

  • Differential Selection Pressures: L. thermotolerans has evolved thermotolerance as an ecological adaptation, whereas S. cerevisiae evolved other specializations

Comparative Genomic Approaches:

A systematic analysis should include:

  • Sequence Evolution Analysis:

    • Calculation of dN/dS ratios to identify sites under positive selection

    • Ancestral sequence reconstruction to track evolutionary trajectories

    • Identification of co-evolving residues between GEP7 and prohibitins

  • Domain Architecture Comparison:

    • Assessment of conserved functional domains versus lineage-specific adaptations

    • Identification of thermostability-associated sequence motifs

    • Analysis of transmembrane domain conservation and adaptation

  • Protein Interaction Network Evolution:

    • Comparison of the prohibitin interactome between species

    • Identification of species-specific interaction partners

    • Analysis of how network rewiring contributes to thermotolerance

Experimental Approaches to Test Evolutionary Hypotheses:

ApproachMethodologyHypothesis TestedExpected Outcome
Domain swappingCreate chimeric proteins with domains from both speciesDomain-specific functional adaptationIdentification of thermotolerance-conferring domains
Ancestral sequence reconstructionExpress reconstructed ancestral proteinsTrajectory of functional evolutionUnderstanding of key adaptive mutations
Complementation assaysExpress L. thermotolerans GEP7 in S. cerevisiae mutantsFunctional conservationDegree of functional complementation at different temperatures
Directed evolutionLaboratory evolution under thermal selectionConvergent vs. divergent adaptationIdentification of potential evolutionary pathways

Evolutionary-Functional Insights:

This comparative approach would reveal how:

  • The GEP7-prohibitin complex adapted to different thermal niches

  • Whole genome duplication influenced the evolution of mitochondrial membrane complexes

  • Species-specific interactions emerged during evolutionary divergence

  • Thermostability adaptations occurred at the molecular level

Understanding these evolutionary adaptations provides both fundamental insights into protein evolution and practical applications for engineering thermotolerance in industrial yeasts.

What are the critical quality control parameters for ensuring functional recombinant GEP7 protein production?

Ensuring functional recombinant GEP7 protein production requires rigorous quality control at multiple stages:

1. Expression System Optimization:

Quality Control ParameterMethodologyAcceptance Criteria
Codon optimizationCodon adaptation index analysisCAI > 0.8 for expression host
Expression levelWestern blot quantificationMinimum 1-5 mg/L culture
Solubility assessmentDetergent screening panel>70% protein in soluble fraction
Expression temperatureComparative expression at 16°C, 25°C, 37°COptimal temperature with minimal inclusion body formation
Induction conditionsIPTG concentration optimizationConcentration yielding maximum soluble protein

2. Protein Purification Quality Control:

ParameterMethodAcceptance Criteria
PuritySDS-PAGE with densitometry>90% purity
Identity confirmationWestern blot; N-terminal sequencing; Mass spectrometryPositive identification with >80% sequence coverage
Aggregation stateSize exclusion chromatography; Dynamic light scattering>90% monodisperse population
Secondary structureCircular dichroism spectroscopySpectrum consistent with predicted secondary structure
Thermal stabilityDifferential scanning fluorimetryTm >40°C for thermotolerant applications

3. Functional Validation:

ParameterMethodAcceptance Criteria
Prohibitin bindingPull-down assay; Surface plasmon resonanceKd in low μM range
Complex formationBlue native electrophoresisFormation of high-molecular-weight complex
Membrane associationLiposome flotation assay>70% protein associated with liposomes
Thermal stability of complexDifferential scanning calorimetryComplex Tm higher than individual components
Chaperone activityPrevention of thermal aggregation of model substratesSignificant reduction in substrate aggregation

4. Storage Stability Assessment:

ParameterMethodAcceptance Criteria
Freeze-thaw stabilityActivity after freeze-thaw cycles<10% activity loss after single freeze-thaw
Long-term storage stabilityActivity after storage at -80°C>80% activity after 6 months
Buffer optimizationStability in various buffer compositionsOptimal stability in Tris/PBS with 6% trehalose at pH 8.0
Lyophilization stabilityActivity after reconstitution>70% activity retention after lyophilization

5. Critical Process Parameters:

  • Membrane Protein-Specific Considerations:

    • Detergent concentration must be maintained above critical micelle concentration

    • Lipid supplementation may be required for stability

    • Avoid detergents that may disrupt prohibitin-GEP7 interactions

  • Functional State Verification:

    • Verify proper folding through limited proteolysis patterns

    • Confirm proper membrane topology using protease protection assays

    • Assess interaction with known binding partners

  • Batch-to-Batch Consistency:

    • Implement robust lot release criteria

    • Establish reference standards for comparative analysis

    • Develop functional assays with appropriate positive controls

These quality control parameters ensure that the recombinant GEP7 protein maintains its native structure and function, particularly its ability to interact with prohibitins and contribute to thermotolerance mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.