Recombinant Lachancea thermotolerans Golgi to ER traffic protein 2 (GET2)

Shipped with Ice Packs
In Stock

Description

Production and Biochemical Properties

Recombinant GET2 is produced in E. coli and purified for research use. Critical parameters include:

ParameterSpecification
StorageLiquid: 6 months at -20°C/-80°C; Lyophilized: 12 months at -20°C/-80°C
ReconstitutionDeionized water (0.1–1.0 mg/mL) + 5–50% glycerol
StabilityAvoid repeated freeze-thaw cycles; working aliquots: 4°C for ≤1 week

Functional Studies:

  • In Vitro Assays: GET1/2 reconstituted in lipid bilayers conducts ions, confirming channel activity .

  • Mutagenesis: Replacing GET2 TMDs with Sec61β or Ost4 TMDs abolishes function, highlighting TMD specificity .

  • Thermotolerance Link: CYR1 mutations in yeast enhance GET2-mediated recombinant protein production at 46°C .

Applications and Biological Significance

GET2’s relevance extends to biotechnology and cellular stress responses:

ApplicationDetails
Recombinant Protein ProductionGET2 homologs improve thermotolerance in K. marxianus, enabling high-yield production under heat stress
TA Protein HomeostasisDefects in GET2 lead to TA protein aggregation, triggering heat shock responses
Cross-Kingdom ConservationPlant GET2 orthologs (e.g., G1IP) retain functional TMDs despite low sequence similarity

Pathway Interactions:

  • GET3: Binds GET2’s cytosolic domains to deliver TA proteins .

  • Sgt2/SGT2: Delivers TA proteins to GET3, forming a relay system .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
GET2; KLTH0A05126g; Golgi to ER traffic protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-306
Protein Length
full length protein
Species
Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) (Yeast) (Kluyveromyces thermotolerans)
Target Names
GET2
Target Protein Sequence
MSEISDAEKRRILREKRQQKFNKGGASSRLAKITGQTENSFLSTESPLDSRESTYPAQET KAPAGNEDSTKQMDELLAKATSKTTSKASSPPGSAEQQNGNPELDLFAQIAKLQQNANNE TVSTDPSGTPDIFAQLMASMQQDEAKGGSPGATAQQPIDPAIVEAHNIAVNKLKSYTILV KWLFFLLPYLYYITHSARDPFQHNAVNYVLDRSNFFTVFTTFEIVALSVYYQLLMSAEKS HNVNTLDNNSKILKLVSMVPPGLVPIPNLRGKVAQALQYWDVVSMYLTDLCFAIVLAGLF QYYHSM
Uniprot No.

Target Background

Function

Recombinant Lachancea thermotolerans Golgi to ER traffic protein 2 (GET2) is essential for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum (ER). In conjunction with GET1, it functions as a membrane receptor for soluble GET3, which specifically recognizes and binds the transmembrane domain of TA proteins within the cytosol. The GET complex collaborates with the HDEL receptor ERD2 to facilitate the ATP-dependent retrieval of ER-resident proteins containing a C-terminal H-D-E-L retention signal from the Golgi apparatus back to the ER.

Database Links
Protein Families
GET2 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is Lachancea thermotolerans and why is it significant in research?

Lachancea thermotolerans is a yeast species that has gained prominence in fermentation research, particularly in wine technology. It represents the type species of the genus Lachancea, which diverged after the emergence of anaerobic capability approximately 125-150 million years ago, prior to the whole-genome duplication event in yeast evolution . This timing places the genus at a critical evolutionary juncture, as it represents the first lineage after the loss of respiratory chain complex I, which occurred after the split of the Saccharomyces-Lachancea and Kluyveromyces-Eremothecium lineages .

The significance of L. thermotolerans in research extends beyond wine production. This yeast has undergone anthropization (adaptation to human-created environments), resulting in strong genomic and phenomic differentiation between strains from different ecological origins . Its adaptability and unique metabolic characteristics, including lactic acid production, make it valuable for various biotechnological applications . Studying this organism provides insights into yeast evolution, adaptation, and specialized metabolic pathways.

What is the Golgi to ER traffic protein 2 (GET2) and what is its function?

The Golgi to ER traffic protein 2 (GET2) is a protein involved in retrograde transport from the Golgi apparatus to the endoplasmic reticulum (ER) in yeast cells. In Lachancea thermotolerans, GET2 is a 306 amino acid protein with a specific sequence that plays a crucial role in vesicular trafficking between these organelles . The protein is part of the GET complex (Guided Entry of Tail-anchored proteins), which is responsible for the proper insertion of tail-anchored proteins into the ER membrane.

The function of GET2 is fundamental to cellular protein sorting and membrane protein integration. It works in concert with other GET complex components to ensure that proteins with a C-terminal transmembrane domain are correctly targeted to the ER membrane. Disruption of this process can lead to proteotoxic stress and cellular dysfunction. The protein's importance in maintaining proper cellular architecture and function makes it a valuable target for researchers studying membrane protein biogenesis and intracellular trafficking.

What strains of Lachancea thermotolerans are typically used for GET2 research?

The most commonly referenced strain for recombinant GET2 research is Lachancea thermotolerans strain ATCC 56472 / CBS 6340 / NRRL Y-8284 . This strain, previously known as Kluyveromyces thermotolerans before taxonomic reclassification, has been fully sequenced and serves as a reference strain for genetic and biochemical studies of L. thermotolerans proteins.

Recent genomic research has identified six well-defined groups of L. thermotolerans strains, primarily delineated by their ecological origin . Anthropized strains (those adapted to human-created environments such as wineries) show lower genetic diversity due to purifying selection imposed by the winemaking environment . When selecting strains for GET2 research, considering the ecological origin and associated genetic characteristics can be important, as these factors may influence protein expression levels and functional properties.

What are the most effective methods for expressing recombinant Lachancea thermotolerans GET2?

Expression of recombinant L. thermotolerans GET2 requires careful consideration of expression systems and conditions. The full-length protein (amino acids 1-306) can be expressed in various host systems, with E. coli and yeast expression systems being most common . When designing an expression strategy, researchers should consider:

  • Expression vector selection: Vectors containing strong inducible promoters (such as T7 for bacterial systems or GAL1 for yeast systems) generally yield better expression. The choice of affinity tags (His, GST, etc.) should be based on downstream purification and application needs.

  • Host strain optimization: For heterologous expression, BL21(DE3) or Rosetta E. coli strains are often effective for yeast proteins. For homologous expression, S. cerevisiae or Pichia pastoris systems may provide proper post-translational modifications.

  • Induction conditions: Temperature, induction duration, and inducer concentration significantly impact protein yield and solubility. Lower temperatures (16-20°C) often improve solubility of recombinant proteins.

  • Codon optimization: Adapting the L. thermotolerans GET2 coding sequence to the codon usage of the host organism can significantly improve expression efficiency, particularly in heterologous systems.

When working with membrane-associated proteins like GET2, solubilization strategies are critical. Including appropriate detergents (such as n-dodecyl β-D-maltoside or CHAPS) in the lysis and purification buffers helps maintain protein solubility and native conformation.

How should researchers design experiments to study GET2 protein interactions?

Designing robust experiments to study GET2 protein interactions requires multiple complementary approaches to validate findings. An effective experimental design strategy includes:

  • In vitro binding assays: Pull-down assays using purified recombinant GET2 with potential interaction partners can establish direct binding. Surface Plasmon Resonance (SPR) or Isothermal Titration Calorimetry (ITC) provide quantitative measurements of binding affinities and kinetics.

  • Co-immunoprecipitation (Co-IP): For cellular validation, developing antibodies against L. thermotolerans GET2 or using epitope-tagged versions enables Co-IP experiments to identify interaction partners in near-native conditions.

  • Yeast two-hybrid screening: Modified to accommodate membrane proteins, this approach can identify novel interaction partners for GET2 in a cellular context.

  • Proximity labeling: BioID or APEX2 fusions to GET2 allow for identification of proximal proteins in living cells, capturing even transient interactions.

  • Crosslinking mass spectrometry: Chemical crosslinking followed by mass spectrometry analysis can map specific interaction interfaces between GET2 and its partners.

What are the recommended conditions for storage and handling of recombinant GET2 protein?

Proper storage and handling of recombinant GET2 protein are crucial for maintaining its structural integrity and functional activity. Based on established protocols for similar proteins, recommended storage conditions include:

  • Short-term storage (1-2 weeks): Store at 4°C in an appropriate buffer system (typically Tris-based buffer with 50% glycerol) .

  • Long-term storage: Store at -20°C or -80°C in single-use aliquots to avoid repeated freeze-thaw cycles .

  • Buffer composition: The storage buffer should be optimized for GET2 stability, typically containing:

    • 50 mM Tris-HCl, pH 7.5-8.0

    • 150-300 mM NaCl

    • 1-5 mM DTT or 2-mercaptoethanol (reducing agent)

    • 50% glycerol as a cryoprotectant

    • Protease inhibitors may be added for additional stability

When handling the protein, researchers should minimize exposure to extreme temperatures, avoid repeated freeze-thaw cycles, and work quickly when the protein is diluted from its storage buffer. If working with very dilute protein solutions, the addition of carrier proteins (such as BSA at 0.1 mg/ml) can prevent adsorption losses to tubes and surfaces.

How can researchers use GET2 to study evolutionary adaptations in Lachancea thermotolerans?

GET2 provides an excellent model for studying evolutionary adaptations in L. thermotolerans across different ecological niches. Researchers can leverage this protein in several ways:

  • Comparative sequence analysis: By sequencing the GET2 gene from multiple L. thermotolerans strains spanning the six identified genomic groups , researchers can identify amino acid substitutions that correlate with ecological adaptations. Calculating Ka/Ks ratios (non-synonymous to synonymous substitution rates) can reveal whether GET2 has undergone positive, purifying, or neutral selection in different lineages.

  • Functional complementation studies: Expressing GET2 variants from different L. thermotolerans strains in S. cerevisiae GET2 deletion mutants can assess functional conservation and adaptation. Measuring growth rates, protein trafficking efficiency, and stress responses provides insights into functional divergence.

  • Protein structure-function analyses: Using homology modeling based on known GET2 structures from related species, researchers can map strain-specific amino acid variations onto the protein structure to identify potentially adaptive changes in functional domains.

  • Experimental evolution: Subjecting L. thermotolerans to controlled selective pressures (such as temperature stress or ethanol exposure) and then sequencing the GET2 gene across generations can capture real-time adaptive mutations.

This approach connects genomic anthropization patterns observed in L. thermotolerans with specific molecular mechanisms, potentially revealing how protein trafficking adaptations contribute to fitness in different environments, particularly the winemaking environment where specific selective pressures have shaped yeast evolution.

What methodological approaches should be used to study the role of GET2 in tail-anchored protein insertion?

Studying the role of GET2 in tail-anchored protein insertion requires specialized methodologies that address both in vitro mechanistic questions and in vivo physiological relevance. A comprehensive research approach should include:

  • In vitro reconstitution assays: Purified components of the GET pathway, including GET2, can be used to reconstitute tail-anchored protein insertion into liposomes. This allows for precise control of the experimental system and direct observation of GET2's contribution.

  • Site-directed mutagenesis: Creating specific mutations in conserved residues of GET2 helps identify critical functional domains. Each mutant should be tested in both in vitro binding assays and in vivo functional complementation studies.

  • Real-time monitoring techniques: Developing fluorescently labeled tail-anchored proteins and GET complex components enables real-time visualization of the insertion process using techniques such as FRET (Förster Resonance Energy Transfer) or fluorescence correlation spectroscopy.

  • Cryo-electron microscopy: For structural studies, cryo-EM of GET2-containing complexes during different stages of the insertion process can provide mechanistic insights at near-atomic resolution.

  • Proteomics approach: Quantitative proteomics comparing wild-type and GET2-deficient cells can identify the global spectrum of tail-anchored proteins affected by GET2 dysfunction. This should be coupled with subcellular fractionation to determine protein mislocalization patterns.

When designing these experiments, researchers should employ true experimental designs with appropriate controls . This includes randomization of samples to control groups and experimental groups, systematic manipulation of independent variables (such as GET2 concentration or mutation type), and precise measurement of dependent variables (such as insertion efficiency or protein localization) .

What are common issues in GET2 expression and purification, and how can they be resolved?

Researchers often encounter several challenges when expressing and purifying recombinant GET2. Here are common issues and their solutions:

  • Low expression yield:

    • Problem: GET2 expression levels are too low for downstream applications.

    • Solutions: Optimize codon usage for the expression host; try different promoters; test multiple induction conditions (temperature, inducer concentration, duration); use an expression strain with rare tRNAs if codon bias is an issue.

  • Protein insolubility:

    • Problem: GET2 forms inclusion bodies or aggregates during expression.

    • Solutions: Lower the expression temperature (16-20°C); co-express with chaperones; use solubility-enhancing fusion tags (MBP, SUMO); optimize lysis buffer with mild detergents appropriate for membrane-associated proteins.

  • Protein degradation:

    • Problem: GET2 shows degradation bands on SDS-PAGE.

    • Solutions: Add protease inhibitors to all buffers; work at 4°C; reduce purification time; consider adding stabilizing agents like glycerol or specific ions based on protein characteristics.

  • Loss of activity after purification:

    • Problem: Purified GET2 shows reduced functional activity.

    • Solutions: Test different buffer compositions; include reducing agents to maintain disulfide bond status; determine if co-factors are required; validate protein folding using circular dichroism or limited proteolysis.

  • Aggregation during storage:

    • Problem: Purified GET2 aggregates during storage.

    • Solutions: Add glycerol (up to 50%) to storage buffer ; aliquot and flash-freeze; avoid repeated freeze-thaw cycles; determine optimal protein concentration for storage.

Each troubleshooting strategy should be methodically tested, with only one variable changed at a time to identify the specific factor affecting GET2 expression or purification. Detailed record-keeping of all conditions tested is essential for optimizing protocols.

How should researchers analyze and interpret data from GET2 functional assays?

Proper analysis and interpretation of data from GET2 functional assays requires rigorous statistical approaches and careful consideration of experimental variables. Researchers should follow these guidelines:

How can researchers differentiate between direct and indirect effects when studying GET2 function?

Differentiating between direct and indirect effects is a critical challenge when studying GET2 function. Multiple complementary approaches should be employed:

  • Temporal resolution studies:

    • Utilize time-course experiments to establish the sequence of events

    • Rapid induction or repression systems (such as auxin-inducible degrons) can provide acute perturbation of GET2 levels

    • Early effects are more likely to be direct, while delayed effects may represent downstream consequences

  • Dose-response relationships:

    • Titrate GET2 levels or activity using conditional expression systems

    • Direct effects typically show proportional responses to GET2 levels

    • Indirect effects may show threshold behaviors or non-linear relationships

  • In vitro reconstitution:

    • Perform experiments with purified components to test direct biochemical activities

    • If a phenotype can be recapitulated with purified components, it strongly suggests a direct effect

    • Comparison between in vitro and in vivo results can highlight potential indirect contributions

  • Interaction-deficient mutants:

    • Create GET2 variants that specifically disrupt particular interactions

    • If disrupting a specific interaction abolishes a phenotype, that interaction is likely directly involved

    • Separation-of-function mutants can help dissect complex phenotypes

  • Computational modeling:

    • Develop mathematical models incorporating known GET pathway components

    • Test whether observed phenotypes can be explained by direct effects or require additional factors

    • Use sensitivity analysis to identify key parameters that influence system behavior

When interpreting results, researchers should consider known GET2 functions in protein trafficking and membrane insertion. Effects that align with these established roles are more likely to be direct, while phenotypes in seemingly unrelated processes warrant careful investigation for indirect mechanisms.

What are the key structural and functional characteristics of Lachancea thermotolerans GET2?

The following table summarizes the key structural and functional characteristics of Lachancea thermotolerans GET2 protein:

FeatureDescriptionReference
Protein Length306 amino acids
UniProt AccessionC5DBT1
Molecular Weight~34 kDa (calculated)
Cellular LocalizationER membrane
Functional DomainTransmembrane regions for membrane anchoring
Complex FormationPart of the GET complex (with GET1, GET3)Inferred from homology
Amino Acid SequenceMSEISDAEKRRILREKRQQKFN... (full sequence in )
Expression Region1-306 (full length protein)
Taxonomic SourceLachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)

This protein shares structural and functional similarities with GET2 proteins from other yeast species, particularly in the regions involved in interaction with other GET complex components and in the membrane-spanning domains. The protein's relatively conserved nature across yeast species suggests its fundamental role in tail-anchored protein targeting has been maintained throughout evolutionary diversification.

How does GET2 from Lachancea thermotolerans compare to homologous proteins in other yeast species?

Comparative analysis of GET2 across yeast species reveals important evolutionary patterns and functional conservation. The table below presents a comparison of key features:

The conservation patterns observed in GET2 across these species reflect both the fundamental importance of its function and the evolutionary pressures specific to different yeast lineages. Regions involved in core GET complex interactions show higher conservation, while peripheral domains display greater sequence divergence. This pattern is consistent with the purifying selection observed in other Lachancea thermotolerans genes that confer fitness in specialized environments .

Notably, L. thermotolerans occupies an interesting evolutionary position, having diverged after the appearance of anaerobic capability but before the whole-genome duplication event . This makes its GET2 particularly valuable for understanding the evolution of protein trafficking mechanisms during the adaptation to different metabolic strategies, including the Crabtree effect which allows fermentation even in the presence of oxygen .

What are promising areas for future research on Lachancea thermotolerans GET2?

Several promising research directions could advance our understanding of L. thermotolerans GET2 and its broader biological significance:

  • Structural biology: Determining the high-resolution structure of L. thermotolerans GET2 would provide valuable insights into species-specific adaptations. Cryo-electron microscopy of the GET complex including GET2 could reveal conformational changes during the tail-anchored protein insertion cycle.

  • Systems biology approaches: Integrating GET2 function into genome-scale metabolic models of L. thermotolerans could reveal connections between protein trafficking and the unique metabolic capabilities of this yeast, particularly in relation to lactic acid production and fermentation characteristics .

  • Comparative genomics: Expanding the analysis of GET2 sequence and function across the six genomic groups of L. thermotolerans could identify specific adaptations related to ecological niches. This could reveal how protein trafficking machinery has been fine-tuned during the anthropization process.

  • Synthetic biology applications: Engineered variants of GET2 could potentially enhance protein production capabilities or stress resistance in biotechnological applications. The unique properties of L. thermotolerans GET2 might offer advantages over traditional S. cerevisiae systems, particularly for proteins requiring specific trafficking conditions.

  • Interactome mapping: Comprehensive identification of GET2 interaction partners across different environmental conditions could reveal condition-specific roles and regulatory mechanisms. This might connect GET2 function to the adaptation mechanisms that allow L. thermotolerans to thrive in challenging environments like wine fermentation.

These research directions would not only advance our fundamental understanding of GET2 function but could also lead to biotechnological applications leveraging the unique properties of L. thermotolerans.

How might GET2 research contribute to our understanding of yeast evolution and adaptation?

GET2 research offers a unique window into yeast evolution and adaptation processes for several compelling reasons:

  • Evolutionary marker: As part of the essential protein trafficking machinery, GET2 evolution likely reflects broader adaptive changes in yeast metabolism and physiology. Its sequence variation across the six defined L. thermotolerans groups could serve as a molecular marker for evolutionary history and adaptive divergence.

  • Anthropization insights: L. thermotolerans has undergone a documented anthropization process, with strains adapting to human-created environments showing distinct genomic signatures . Studying how GET2 has changed during this process could reveal mechanisms by which essential cellular machinery adapts to new selective pressures without compromising core functions.

  • Metabolic adaptation connections: The connection between protein trafficking and metabolic adaptation remains poorly understood. GET2's role in properly localizing membrane proteins likely influences how cells adapt to different carbon sources, stress conditions, and fermentation environments. This could explain some of the phenotypic traits considered domestication hallmarks in anthropized strains, such as increased fitness in the presence of ethanol and sulfites .

  • Pre-whole genome duplication insights: L. thermotolerans diverged after the appearance of anaerobic capability but before the whole-genome duplication event . This places it at a critical evolutionary juncture for understanding how protein trafficking systems adapted during the transition to facultative anaerobiosis and the emergence of the Crabtree effect.

  • Functional innovation mechanisms: Comparing GET2 function across yeast species could reveal how essential cellular machinery can be repurposed or modified during adaptation to new niches. This addresses a fundamental question in evolutionary biology: how do organisms evolve new traits while maintaining essential cellular functions?

By integrating GET2 research with broader studies of yeast genomics, metabolism, and ecology, researchers can develop a more complete picture of how cellular systems co-evolve during adaptation to new environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.