Recombinant Lachancea thermotolerans Monopolar spindle protein 2 (MPS2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MPS2; KLTH0H04312g; Monopolar spindle protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-386
Protein Length
full length protein
Species
Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) (Yeast) (Kluyveromyces thermotolerans)
Target Names
MPS2
Target Protein Sequence
MDTERHATLLLDLVWPEVDEKAQGFIYAKDFPLVVSRMEEILNRGKLERDRAQLVSETGR EILRKFGSDQEFFKVYKEDFRELFDGLVGTSFKSAVKSCAGDGVLDRLQDSQAVDGIQDE KTSSHALQEEVMRLREQVRVLSSKNDEKDREITARDEIIADLQGKDASPAGSPRSLQRMR TLQARVTSLEDELSFRDEVIREKDRELLNLTKRVGEFKDKYQFLEREFQFYKGHREQKSP DSIKEATRHEFIISELRRKITEQSEIIGQMRMQVEAKPGALHPQGIGSTAGLPLNLPLRL VLRLIIGAILAYLAFDIGIRSLKAVGGLFGSSSPATLTPKSELSWWEQNTLLSKLLWFFK DLFDTYNLDAGRDEVVSANYDKLFGV
Uniprot No.

Target Background

Function

A component of the spindle pole body (SPB), MPS2 is essential for the insertion of the nascent SPB into the nuclear envelope and the accurate execution of SPB duplication.

Database Links
Protein Families
MPS2 family
Subcellular Location
Nucleus membrane; Single-pass membrane protein. Cytoplasm, cytoskeleton, microtubule organizing center, spindle pole body.

Q&A

How does Lachancea thermotolerans MPS2 function differ from its Saccharomyces cerevisiae homolog?

The homologous MPS2 in S. cerevisiae is an essential 44-kDa protein involved in spindle pole body (SPB) duplication . Based on comparative genomic studies, L. thermotolerans MPS2 likely retains the core functional properties while exhibiting species-specific adaptations. In S. cerevisiae, MPS2 functions as an integral membrane protein that localizes to the nuclear periphery with higher concentration at the SPB . It is essential for proper insertion of the nascent SPB into the nuclear envelope during cell division. Unlike S. cerevisiae where MPS2 deletion is lethal (though suppressible by POM152 deletion), the specific phenotypic consequences of L. thermotolerans MPS2 mutations remain to be fully characterized .

What are the optimal conditions for expressing recombinant L. thermotolerans MPS2 protein?

For optimal recombinant expression of L. thermotolerans MPS2:

  • Expression System: E. coli has been successfully used as demonstrated in commercially available recombinant MPS2 .

  • Tagging Strategy: N-terminal His-tagging is effective for purification without interfering with protein function .

  • Buffer Conditions: Tris/PBS-based buffer with pH 8.0 and 6% Trehalose provides optimal stability for the purified protein .

  • Storage Recommendations:

    • Store at -20°C/-80°C upon receipt

    • Aliquot to avoid repeated freeze-thaw cycles

    • For long-term storage, add 30-50% glycerol

    • Working aliquots can be maintained at 4°C for up to one week

  • Reconstitution Protocol: Centrifuge vial briefly before opening and reconstitute in deionized sterile water to 0.1-1.0 mg/mL .

What methodological approaches are effective for studying MPS2 localization and interactions in yeast cells?

To study MPS2 localization and interactions in yeast cells, researchers have employed several effective techniques:

  • Fluorescent Protein Tagging: GFP-Mps2p fusion proteins have been successfully used for visualization in living cells .

  • Immunofluorescence Microscopy: 9xmyc-Mps2p tagging followed by indirect immunofluorescence microscopy reveals perinuclear localization with brighter foci at the SPB .

  • Immunoelectron Microscopy: This technique provides ultra-structural localization of GFP-Mps2p specifically to the SPB .

  • Biochemical Fractionation: This approach confirms MPS2 as an integral membrane protein .

  • Co-localization Studies: Using SPB markers like Tub4 helps validate MPS2 localization to the spindle pole body .

  • Time-lapse Fluorescence Microscopy: This technique has been effective for tracking MPS2 dynamics during cell division, showing its separation from one focus to two in meiosis I and from two to four in meiosis II .

For studies examining protein-protein interactions:

  • Co-immunoprecipitation can detect interactions with other proteins like Csm4 and Mps3 .

  • Conditional mutants (temperature-sensitive alleles) help determine functional relationships .

What is the relationship between MPS2 function and evolutionary adaptations in Lachancea thermotolerans?

L. thermotolerans has undergone significant evolutionary adaptation to diverse environments, including anthropization processes evident in wine-related strains . While specific evolutionary adaptations of MPS2 haven't been directly characterized, several key insights can be drawn:

  • Genomic Diversity: L. thermotolerans exhibits high levels of genetic diversity across its six well-defined population groups, primarily delineated by ecological origin .

  • Selective Pressure: Anthropized strains (such as those used in winemaking) show lower genetic diversity due to purifying selection imposed by the winemaking environment .

  • Functional Adaptation: As a component of essential cellular machinery, MPS2 likely experiences selective pressures related to:

    • Temperature adaptation (L. thermotolerans is thermotolerant compared to some yeasts)

    • Membrane composition changes in response to environmental stressors

    • Cell division optimization under fermentative conditions

  • Comparative Analysis: Studies comparing MPS2 sequences across L. thermotolerans genetic groups could reveal differential selection patterns correlating with their ecological niches, particularly between natural isolates and domesticated strains .

The extensive intra-specific diversity observed in L. thermotolerans populations suggests MPS2 may have undergone functional adaptations that contribute to fitness in different environments, particularly in the context of nuclear envelope dynamics and cell division under various stress conditions .

How does Lachancea thermotolerans MPS2 compare functionally with homologs in other yeast species?

Comparative analysis reveals both conservation and divergence in MPS2 function across yeast species:

SpeciesMPS2 FunctionEssentialityLocalizationKey Interactions
L. thermotoleransSPB component, likely involved in nuclear envelope insertionNot fully characterizedPresumed perinuclear with SPB enrichmentNot fully characterized
S. cerevisiaeSPB duplication, nuclear envelope insertionEssential (lethal when deleted)Perinuclear with SPB enrichmentCsm4, Mps3, forms t-LINC complex
Other Lachancea spp.Varying degrees of conservationVariableSimilar perinuclear patternSpecies-specific interactions

The functional differences likely reflect evolutionary adaptations to different ecological niches. While the core SPB function appears conserved, species-specific adaptations may involve:

  • Temperature Tolerance: L. thermotolerans shows greater thermotolerance than some Saccharomyces species, which may be reflected in structural adaptations of nuclear envelope proteins including MPS2 .

  • Meiotic Processes: Differences in sexual reproduction strategies between yeast species may drive functional divergence in MPS2, particularly in its role in the t-LINC complex during meiosis .

  • Membrane Composition: Adaptation to different environments may result in altered nuclear membrane composition, requiring complementary changes in integral membrane proteins like MPS2 .

What does population genomics reveal about MPS2 conservation across Lachancea thermotolerans genetic groups?

Population genomics studies of L. thermotolerans have identified up to nine genetic groups with distinct phenotypic characteristics . While specific analysis of MPS2 conservation across these groups is not directly reported in the literature, several insights can be inferred:

  • Genetic Differentiation: The nine genetic groups show clear separation based on linear discriminant analysis of 107 phenotypic variables , suggesting potential functional differences in core cellular machinery genes including MPS2.

  • Allopatric Differentiation: Geographic isolation has driven genetic divergence in L. thermotolerans populations, likely affecting essential genes like MPS2 through genetic drift and local adaptation .

  • Domestication Signatures: Domesticated strains show evidence of adaptation to fermentative environments, which may include changes in cell division genes to optimize growth under these conditions .

  • Conserved Domains: Despite population-level diversity, functional domains within MPS2 likely show higher conservation due to selection pressure maintaining essential functions in SPB duplication and nuclear envelope integration .

Examining MPS2 sequence variation across these genetic groups could provide valuable insights into how this essential protein adapts to different ecological conditions while maintaining its core cellular functions.

What quality control measures should be implemented when working with recombinant L. thermotolerans MPS2?

When working with recombinant L. thermotolerans MPS2, the following quality control measures are essential:

  • Purity Assessment:

    • SDS-PAGE analysis should confirm >90% purity

    • Western blotting with anti-His antibodies can verify tag presence and integrity

    • Mass spectrometry can confirm the exact molecular weight and detect any post-translational modifications

  • Functional Verification:

    • Structural integrity assessment through circular dichroism

    • When applicable, in vitro binding assays with known interaction partners

    • Thermal shift assays to evaluate protein stability

  • Storage and Handling:

    • Avoid repeated freeze-thaw cycles that can lead to protein degradation

    • Monitor protein stability over time using analytical techniques

    • Aliquot upon receipt to maintain long-term stability

  • Contamination Control:

    • Endotoxin testing for E. coli-expressed proteins

    • Sterile filtration before experimental use

    • Regular testing for microbial contamination in stored samples

  • Batch Consistency:

    • Maintain detailed records of expression conditions

    • Compare new batches with reference standards

    • Document lot-to-lot variation

How can researchers design experiments to elucidate the specific role of MPS2 in Lachancea thermotolerans metabolic adaptations?

To investigate MPS2's role in L. thermotolerans metabolic adaptations, researchers should consider these experimental approaches:

  • Genetic Manipulation Strategies:

    • CRISPR-Cas9 genome editing to create MPS2 mutants

    • Conditional expression systems (e.g., tetracycline-regulated) for essential genes

    • Complementation studies using MPS2 variants from different genetic groups

  • High-Resolution Phenotyping:

    • Comprehensive oenological phenotyping as performed for different L. thermotolerans strains

    • Metabolomic analysis under various stress conditions (temperature, pH, ethanol)

    • Fermentation kinetics measurement under wine-relevant conditions

  • Integrative -Omics Approaches:

    • Transcriptomics to identify genes co-regulated with MPS2

    • Proteomics to map MPS2 interaction networks

    • Comparative genomics across L. thermotolerans genetic groups

  • Environmental Response Studies:

    • Assess MPS2 expression/localization under conditions mimicking wine fermentation

    • Compare responses between natural isolates and domesticated strains

    • Evaluate impact of temperature shifting, mimicking natural fermentation conditions

  • Functional Comparison Framework:

    • Create chimeric proteins between L. thermotolerans and S. cerevisiae MPS2

    • Test complementation of S. cerevisiae mps2 mutants

    • Analyze nuclear envelope structure and SPB function using electron microscopy

These approaches would help connect MPS2 function to the remarkable metabolic properties of L. thermotolerans, such as lactic acid production and temperature adaptability, which make this yeast valuable for winemaking applications .

How might MPS2 function contribute to the unique lactic acid production capability of Lachancea thermotolerans?

While direct evidence linking MPS2 to lactic acid production is not established, several theoretical pathways warrant investigation:

  • Nuclear-Cytoplasmic Communication: As a nuclear envelope protein, MPS2 may influence gene expression patterns controlling metabolic pathways, including those involved in lactic acid production. L. thermotolerans can produce up to 16 g/L of lactic acid during must fermentation, compared to ≤0.4 g/L for S. cerevisiae .

  • Stress Response Integration: MPS2's role in maintaining nuclear envelope integrity could be critical during fermentation stress. L. thermotolerans shows distinctive metabolic responses to stress, including the partial conversion of hexoses to lactic acid rather than ethanol .

  • Cell Cycle Regulation: MPS2 is essential for proper spindle pole body function and cell division. Modified cell cycle progression could affect metabolic flux distribution, potentially favoring lactic acid production under specific conditions.

  • Evolutionary Context: Comparative analysis of MPS2 sequences between high and low lactic acid-producing strains might reveal variants that correlate with this metabolic trait. The formation of lactic acid by wine-related strains has been hypothesized as an "anthropization signature" resulting from adaptation to the fermentative environment .

Experimental designs could include:

  • Monitoring MPS2 expression during different phases of fermentation

  • Correlating MPS2 sequence variants with lactic acid production across strains

  • Testing how MPS2 mutations affect carbon flux distribution during fermentation

What are the implications of MPS2 research for understanding yeast adaptation to industrial environments?

MPS2 research offers valuable insights into yeast adaptation mechanisms:

  • Domestication Markers: MPS2 variants may serve as molecular markers for domestication events in L. thermotolerans. Studies have shown distinct phenotypic performance among L. thermotolerans genetic groups, supporting the occurrence of domestication events and allopatric differentiation .

  • Stress Tolerance Mechanisms: Understanding how MPS2 contributes to nuclear integrity during fermentation stresses could explain adaptation differences between wild and domesticated strains. Wine-related strains show increased fitness in the presence of ethanol and sulfites, which may involve adaptations in membrane proteins like MPS2 .

  • Biotechnological Applications: Engineered MPS2 variants could potentially enhance L. thermotolerans performance in industrial settings. This yeast's ability to regulate titratable acidity, pH, and ethanol content makes it promising for production of quality wine products, especially relevant in the context of global warming .

  • Evolutionary Model: L. thermotolerans provides an excellent model for studying industrial domestication processes distinct from the well-characterized S. cerevisiae. The species shows strong differentiation both genomically and phenomically due to anthropization processes .

  • Comparative Framework: L. thermotolerans adaptation patterns, potentially involving MPS2, demonstrate how fermentation environments give rise to similar adaptations in different yeast species, offering a comparative framework for studying parallel evolution .

This research area connects fundamental cell biology (nuclear envelope structure and function) with applied microbiology (fermentation optimization), highlighting how basic research on proteins like MPS2 can inform industrial applications.

What are the major challenges in studying MPS2 function in Lachancea thermotolerans and how can they be addressed?

Research on L. thermotolerans MPS2 faces several methodological challenges:

  • Genetic Manipulation Limitations:

    • Challenge: L. thermotolerans has less developed genetic tools compared to S. cerevisiae

    • Solution: Adapt CRISPR-Cas9 systems optimized for non-conventional yeasts; utilize heterologous expression systems for initial functional studies

  • Essential Gene Status:

    • Challenge: If MPS2 is essential (as in S. cerevisiae), deletion studies may be impossible

    • Solution: Create conditional mutants using tetracycline-regulated promoters or temperature-sensitive alleles; explore suppressor mutations (like POM152 deletion in S. cerevisiae)

  • Strain Diversity:

    • Challenge: High genetic diversity across L. thermotolerans strains complicates standardization

    • Solution: Select representative strains from each genetic group ; create a reference panel covering the species' diversity

  • Protein Localization:

    • Challenge: Visualizing membrane proteins in non-conventional yeasts

    • Solution: Optimize fluorescent protein fusions for L. thermotolerans; adapt immunolocalization protocols from S. cerevisiae studies

  • Functional Conservation Assessment:

    • Challenge: Determining if L. thermotolerans MPS2 functions similarly to S. cerevisiae homolog

    • Solution: Complementation studies in S. cerevisiae mps2 mutants; comparative localization studies

  • Industrial Relevance Connection:

    • Challenge: Linking basic MPS2 biology to industrial traits

    • Solution: Correlate MPS2 variants with fermentation performance ; study MPS2 expression during actual wine fermentations

How can researchers effectively differentiate between direct and indirect effects when studying MPS2 functions?

Distinguishing direct from indirect effects requires systematic experimental design:

  • Proximity-Based Approaches:

    • BioID or APEX2 proximity labeling to identify proteins in close physical association with MPS2

    • Split-GFP complementation to confirm direct interactions with candidate partners

    • FRET/BRET analysis for real-time interaction monitoring in living cells

  • Temporal Resolution Studies:

    • Use rapid induction/repression systems to identify immediate versus delayed effects

    • Time-course analyses following MPS2 perturbation to establish cause-effect relationships

    • Single-cell analysis techniques to capture cell-to-cell variability in responses

  • Domain-Specific Mutations:

    • Create targeted mutations affecting specific MPS2 domains rather than whole protein deletion

    • Design separation-of-function mutants that disrupt individual interactions

    • Use chimeric proteins to map functional domains responsible for specific phenotypes

  • Multi-Omics Integration:

    • Combine transcriptomics, proteomics, and metabolomics to build causal networks

    • Use network analysis to distinguish primary from secondary effects

    • Apply mathematical modeling to predict system behavior following MPS2 perturbation

  • Comparative Analysis Across Conditions:

    • Study MPS2 function under multiple environmental conditions

    • Compare effects in different genetic backgrounds to identify condition-specific functions

    • Use evolutionary conservation as a filter to identify core versus species-specific functions

These approaches help create a more complete understanding of MPS2's role in L. thermotolerans biology, distinguishing its direct biochemical functions from broader physiological consequences of its perturbation.

What emerging technologies could advance our understanding of MPS2 structure and function?

Several cutting-edge technologies show promise for MPS2 research:

  • Cryo-Electron Microscopy:

    • High-resolution structural determination of MPS2 in its membrane context

    • Visualization of MPS2-containing complexes at the nuclear envelope

    • Structural comparison of MPS2 from different L. thermotolerans genetic groups

  • In-Cell NMR Spectroscopy:

    • Study MPS2 dynamics within living yeast cells

    • Monitor conformational changes under different environmental conditions

    • Investigate protein-protein interactions in native cellular environment

  • Single-Cell Multi-Omics:

    • Correlate MPS2 expression with metabolic profiles at single-cell resolution

    • Identify cell-to-cell variability in MPS2 function during fermentation

    • Map cellular trajectories following environmental perturbations

  • Long-Read Sequencing Technologies:

    • Improved genomic analysis of L. thermotolerans populations

    • Better characterization of structural variants affecting MPS2 locus

    • Enhanced understanding of regulatory elements controlling MPS2 expression

  • Microfluidic Approaches:

    • High-throughput phenotyping of MPS2 variants

    • Real-time monitoring of cellular responses to changing environments

    • Single-cell tracking of MPS2 dynamics during cell division

  • Advanced Imaging Technologies:

    • Super-resolution microscopy for detailed visualization of MPS2 localization

    • Live-cell imaging to track MPS2 movement during fermentation stress

    • Correlative light and electron microscopy for structural-functional relationships

How might comprehensive understanding of MPS2 contribute to biotechnological applications of Lachancea thermotolerans?

A deeper understanding of MPS2 could enhance L. thermotolerans applications in several ways:

  • Strain Improvement:

    • Engineering MPS2 variants for improved stress tolerance during fermentation

    • Selection of natural MPS2 variants associated with desired fermentation traits

    • Development of screening markers based on MPS2 characteristics to identify promising strains

  • Bioprocess Optimization:

    • Rational design of fermentation conditions based on MPS2 expression patterns

    • Monitoring MPS2 status as a biomarker for cellular health during fermentation

    • Predicting strain performance in industrial settings based on MPS2 variants

  • Wine Quality Enhancement:

    • Selecting strains with MPS2 variants associated with optimal lactic acid production

    • Improving wine acidification bioprocesses to address issues related to climate change

    • Developing L. thermotolerans strains with enhanced glycerol production while maintaining desirable acid profiles

  • Expanded Industrial Applications:

    • Adaptation of L. thermotolerans for non-wine fermentations

    • Development of specialized strains for different beverage types

    • Creation of lactic acid production platforms for sustainable chemical manufacturing

  • Fundamental Research Benefits:

    • Using L. thermotolerans as a model system for studying yeast domestication

    • Understanding parallel evolutionary processes across yeast species

    • Identifying general principles of microbial adaptation to human-created niches

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.