Recombinant Lachancea thermotolerans Probable metalloreductase AIM14 (AIM14)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The protein is synthesized via recombinant DNA technology:

  • Cloning: The AIM14 gene is codon-optimized for E. coli expression .

  • Expression: Induced under optimized conditions in E. coli cultures.

  • Purification: Affinity chromatography using the His tag, followed by buffer exchange and lyophilization .

  • Reconstitution: Recommended in deionized water (0.1–1.0 mg/mL) with 5–50% glycerol for stability .

Biochemical Properties

  • Thermal Stability: No direct data, but storage at -80°C is advised to prevent degradation .

  • Activity Assays: No peer-reviewed studies confirming metalloreductase activity or substrate specificity are available.

  • Functional Hypotheses: Metalloreductases generally mediate metal ion reduction (e.g., Fe³⁺ to Fe²⁺), suggesting potential roles in oxidative stress response or metal homeostasis .

Limitations and Future Directions

  • Knowledge Gaps: No kinetic parameters, structural models, or in vivo functional data exist.

  • Research Needs:

    • Validation of enzymatic activity using assays like cytochrome c reduction.

    • Comparative studies with metalloreductases from related species (e.g., Saccharomyces).

    • Exploration of industrial or biomedical relevance .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will do our best to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this to us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference point for your own protocols.
Shelf Life
The shelf life of our products is influenced by various factors including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Please note that the tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
AIM14; KLTH0H11550g; Probable metalloreductase AIM14
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-533
Protein Length
full length protein
Species
Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) (Yeast) (Kluyveromyces thermotolerans)
Target Names
AIM14
Target Protein Sequence
MAMTLLPRHGKTHLANIPYGYYTATVSLIFIILLIGARKLIPVRQRNRSKWAKWALSSAR GGSPLLYLVVLFVALLVPFVHHYSLLGYVGLYLKRLGRLSYVLATLNLFLTLRPNFLLPG YVYLDLIPLHKWLSRSLCLLALVHGVGFLVKWALDSQVSFVAKAFYNIPNLAGLVVGALM AFMVLLSVRPVRRFSYRSFYLTHIIGAWVFVFLTAYHARPGVFVPYTLLNAGLFVFYILS KTVPARGVELVSKSTDDVNNCLTRIVLPRKAMPEHFAPGSHLRISPYRRVNPLYYMLPSH PYTVASMPEDKDVELIVREHASGFHLLTGLGYTIQNHYESVPRQCLQSATRIALVCGGSG LSYALPIFRHFASEEKADQVKYLRLIWLVRDKYDVNVLGNIRSLASSVAQFDIFVTRSVP PDDTVESGSKLSPAQQQSPITDDLEFELESFGDQLDQNGALITPEIPNLPSGLASSFHFG RKLDWMTDLAQFVEREDLGSTWLVACGPKGLNDAAKLYAQQNEINLASETYAL
Uniprot No.

Target Background

Function
This protein is a probable cell surface metalloreductase. It may be involved in iron or copper homeostasis.
Database Links
Protein Families
Ferric reductase (FRE) family, AIM14 subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is AIM14 metalloreductase from Lachancea thermotolerans?

AIM14 (gene name: AIM14, locus: KLTH0H11550g) is a probable metalloreductase from the yeast Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284), previously known as Kluyveromyces thermotolerans. The enzyme belongs to the EC 1.16.1.- class of oxidoreductases that act on metal ions as electron acceptors. The protein has a UniProt accession number of C5E398 and consists of 533 amino acids in its full-length form . As a metalloreductase, it likely plays a role in metal ion homeostasis or detoxification pathways within the yeast cell, though its precise physiological function requires further characterization through targeted experimental approaches.

What are the optimal storage and handling conditions for recombinant L. thermotolerans AIM14?

For optimal activity preservation, recombinant L. thermotolerans AIM14 should be stored in a Tris-based buffer containing 50% glycerol . Long-term storage should be at -20°C or -80°C for extended preservation. Repeated freeze-thaw cycles significantly reduce enzyme activity and should be avoided; instead, prepare small working aliquots and store at 4°C for up to one week of active use .

When handling the protein for experiments, maintain temperature control and consider adding protease inhibitors if working with crude extracts. The addition of appropriate metal cofactors may be necessary for optimal enzymatic activity, though specific requirements need to be determined experimentally. For kinetic assays, stability testing under different pH conditions (likely in the range of pH 5.5-7.5) is recommended as metalloreductases generally show pH-dependent activity profiles.

How can researchers effectively express and purify recombinant L. thermotolerans AIM14 for functional studies?

Expression System Selection:
E. coli systems (BL21(DE3) or Rosetta strains) are suitable for initial expression trials, though potential issues with membrane-associated proteins may necessitate using eukaryotic systems like P. pastoris or S. cerevisiae for proper folding and post-translational modifications.

Optimization Protocol:

  • Clone the KLTH0H11550g gene into an expression vector with appropriate tags (His6 or GST)

  • Transform into the chosen expression host

  • Optimize induction conditions (temperature, inducer concentration, expression time)

  • For membrane-associated proteins like AIM14, inclusion of detergents during lysis may improve solubility

  • Purify using affinity chromatography followed by size exclusion chromatography

Critical Considerations:

  • Include metal ions (Fe2+, Cu2+, etc.) during purification steps to maintain structural integrity

  • Validate protein activity using spectrophotometric assays measuring metal reduction capacity

  • Confirm protein identity through mass spectrometry and western blotting

  • Consider tag removal if the tag interferes with activity assays

What enzymatic assays are most appropriate for measuring L. thermotolerans AIM14 metalloreductase activity?

Recommended Assays:

  • Ferric Reductase Assay:

    • Substrate: Fe3+ compounds (ferric citrate, ferric chloride)

    • Detection: Formation of Fe2+ using ferrozine as colorimetric indicator

    • Measurement: Absorbance at 562 nm

    • Controls: Heat-inactivated enzyme and no-enzyme controls

  • Copper Reductase Assay:

    • Substrate: Cu2+ compounds (copper sulfate)

    • Detection: Bathocuproine disulfonate for Cu+ detection

    • Measurement: Absorbance at 483 nm

  • General Metal Reduction Assay:

    • Substrate: Multiple transition metals

    • Detection: Change in oxidation state using appropriate indicators

    • Analysis: Comparative kinetics to determine metal preference

Kinetic Parameters to Determine:

  • Km and Vmax for different metal substrates

  • Optimal pH and temperature ranges

  • Effects of potential inhibitors

  • Cofactor requirements (NADH, NADPH)

How does L. thermotolerans AIM14 compare to metalloreductases in related yeast species?

L. thermotolerans AIM14 belongs to the metalloreductase family found across various yeast species, but with distinctive evolutionary characteristics that reflect its ecological adaptation. Comparative genomic analyses reveal that L. thermotolerans diverged after the appearance of anaerobic capability, approximately 125-150 million years ago, and represents the first lineage after the loss of respiratory chain complex I . This evolutionary history positions AIM14 as particularly interesting for comparative studies.

When comparing to Saccharomyces cerevisiae metalloreductases:

  • L. thermotolerans AIM14 shows sequence conservation in catalytic domains but divergence in regulatory regions

  • The protein likely retains core metal reduction functionality while exhibiting species-specific substrate preferences

  • The gene regulation patterns may differ significantly due to the distinct ecological niches occupied by these yeasts

Phylogenetic analysis places L. thermotolerans in a clade that shows greater diversity compared to the Saccharomyces group , suggesting that AIM14 may have evolved distinct properties that reflect adaptation to specific environmental conditions. Examining these differences can provide insights into how metalloreductases have adapted to different ecological pressures across yeast evolution.

What role might AIM14 play in L. thermotolerans adaptation to different ecological niches?

Recent genomic and phenotypic studies of L. thermotolerans have revealed that this species shows clear adaptation patterns to different environments, particularly anthropized (human-associated) niches like winemaking . While AIM14 is not explicitly discussed in these adaptation studies, metalloreductases generally play important roles in metal homeostasis and stress response.

Potential Adaptive Functions:

  • Winemaking Environment Adaptation:

    • Metal detoxification in high-sulfite environments typical in winemaking

    • Modulation of metal ion availability during fermentation

    • Potential contribution to stress response mechanisms under high ethanol conditions

  • Ecological Niche Specialization:

    • Different L. thermotolerans strains show genetic diversification based on their ecological origin

    • AIM14 variants may contribute to fitness in specific niches through specialized metal management

    • Gene duplication or modification events affecting AIM14 might correlate with adaptation signatures

  • Relationship to Metabolic Adaptations:

    • L. thermotolerans has undergone adaptation in genes related to alternative carbon and nitrogen source utilization (like MAL1 and DAL5)

    • AIM14 may interact with these metabolic adaptations through metal cofactor provision

    • The protein could be involved in redox balance maintenance during fermentation

Experimental approaches comparing AIM14 sequence, expression, and activity across L. thermotolerans strains from different ecological origins would help elucidate its potential role in adaptation processes.

How might genomic variations in L. thermotolerans strains affect AIM14 function and expression?

Whole-genome sequencing studies have revealed that L. thermotolerans exhibits significant genomic diversity across different strains, with six well-defined groups primarily delineated by ecological origin . This genetic diversity may impact AIM14 function and expression in several ways:

Potential Genomic Variation Effects:

  • Coding Sequence Polymorphisms:

    • Single nucleotide polymorphisms (SNPs) in the AIM14 gene (KLTH0H11550g) could alter catalytic efficiency

    • Amino acid substitutions near metal-binding sites might modify substrate specificity

    • Changes in transmembrane domains could affect subcellular localization

  • Regulatory Region Variations:

    • Promoter polymorphisms may lead to differential expression across strains

    • Transcription factor binding site modifications could alter response to environmental stressors

    • Strains from anthropized environments may show different expression patterns compared to wild strains

  • Copy Number Variations:

    • Like observed with other genes (MAL1, DAL5) in L. thermotolerans , AIM14 might exhibit copy number variations

    • Gene duplication events could lead to neofunctionalization or subfunctionalization

    • Loss-of-function variants might exist in strains where specific metal reduction activities are not advantageous

Research approaches combining comparative genomics, transcriptomics, and functional assays across diverse L. thermotolerans strains would reveal how genomic variations impact AIM14 functionality and contribute to strain-specific phenotypes.

What methodological approaches are most effective for studying the physiological role of AIM14 in L. thermotolerans?

Understanding the physiological role of AIM14 requires a multi-faceted approach combining genetic, biochemical, and systems biology methods:

Recommended Methodological Framework:

  • Gene Knockout/Knockdown Studies:

    • CRISPR-Cas9 gene editing to create AIM14-deficient strains

    • Analysis of phenotypic changes under various metal stress conditions

    • Complementation studies with wild-type and mutant AIM14 variants

  • Localization and Interaction Studies:

    • Fluorescent protein tagging to determine subcellular localization

    • Co-immunoprecipitation to identify protein interaction partners

    • Proximity labeling methods (BioID, APEX) to map the protein interaction network

  • Systems Biology Approaches:

    • Transcriptomic analysis comparing wild-type and AIM14-deficient strains

    • Metabolomic profiling to identify changes in metal-dependent pathways

    • Comparative analysis across different ecological strains to correlate AIM14 sequence variants with phenotypes

  • Metal Homeostasis Assays:

    • ICP-MS analysis of cellular metal content in wild-type vs. mutant strains

    • Metal stress response assays (growth curves in metal-supplemented media)

    • Redox state measurements using fluorescent probes

  • Heterologous Expression:

    • Expression of L. thermotolerans AIM14 in S. cerevisiae metalloreductase mutants

    • Functional complementation analysis to determine conserved functions

    • Cross-species activity comparison to identify species-specific adaptations

These methodological approaches should be implemented in both laboratory and simulated natural conditions (e.g., grape must fermentation) to understand the ecological relevance of AIM14 function.

How can researchers investigate potential biotechnological applications of L. thermotolerans AIM14?

L. thermotolerans has garnered interest for biotechnological applications, particularly in winemaking due to its lactic acid production capabilities that help address issues related to climate change effects on grape musts . The AIM14 metalloreductase may offer additional biotechnological potential:

Research Directions for Biotechnological Applications:

  • Bioremediation Applications:

    • Characterize AIM14 activity toward heavy metals and toxic metal species

    • Engineer optimized variants with enhanced metal reduction/detoxification capabilities

    • Develop immobilized enzyme systems for environmental remediation

  • Wine and Beverage Production:

    • Investigate AIM14's role in metal-dependent flavor development during fermentation

    • Analyze how metal reduction activities influence wine stability and sensory properties

    • Develop L. thermotolerans strains with modified AIM14 expression for optimized fermentation outcomes

  • Biosensor Development:

    • Exploit metal-specific reduction activity for development of biosensors

    • Engineer reporter systems linked to AIM14 activity for detection of specific metals

    • Develop whole-cell biosensors using L. thermotolerans for environmental monitoring

  • Enzyme Engineering:

    • Structure-function analysis to identify catalytic residues

    • Directed evolution approaches to enhance thermostability or substrate range

    • Protein engineering for improved activity in industrial conditions

Experimental approaches should include activity screening against diverse metal substrates, protein engineering efforts, and application-specific testing in relevant conditions (fermentation environments, contaminated water samples, etc.).

What are common challenges in working with recombinant metalloreductases like AIM14, and how can they be addressed?

Researchers working with metalloreductases like L. thermotolerans AIM14 frequently encounter several technical challenges:

Challenge 1: Protein Solubility and Stability

  • Problem: Transmembrane regions in AIM14 can cause aggregation and insolubility

  • Solutions:

    • Use specialized detergents (DDM, CHAPS) during extraction and purification

    • Express truncated versions lacking transmembrane domains

    • Optimize buffer conditions with stabilizing agents (glycerol, specific metal ions)

    • Consider fusion partners (MBP, SUMO) to enhance solubility

Challenge 2: Maintaining Enzymatic Activity

  • Problem: Metalloreductases often lose activity during purification

  • Solutions:

    • Include appropriate metal cofactors in all buffers

    • Maintain reducing conditions with DTT or β-mercaptoethanol

    • Avoid chelating agents (EDTA) that may strip essential metals

    • Use anaerobic conditions for oxygen-sensitive reactions

Challenge 3: Assay Interference

  • Problem: Metal reduction assays are susceptible to interference

  • Solutions:

    • Include appropriate blanks and controls for each assay condition

    • Use multiple orthogonal assay methods to confirm activity

    • Consider oxygen exclusion for assays involving easily oxidized metals

    • Account for possible buffer component interference

Challenge 4: Heterologous Expression

  • Problem: Poor expression yields or incorrect folding

  • Solutions:

    • Try multiple expression systems (E. coli, P. pastoris, S. cerevisiae)

    • Optimize codon usage for the expression host

    • Adjust induction conditions (temperature, inducer concentration)

    • Consider co-expression with chaperones

How can researchers effectively differentiate the specific activity of AIM14 from other metalloreductases in mixed samples?

Distinguishing AIM14 activity from other metalloreductases requires targeted approaches that exploit unique characteristics of this enzyme:

Differential Analysis Strategies:

  • Immunological Methods:

    • Develop AIM14-specific antibodies for immunodepletion studies

    • Use immunoprecipitation to isolate AIM14 from mixed samples

    • Perform western blot analysis alongside activity assays

  • Substrate Specificity Profiling:

    • Determine unique metal substrate preferences of AIM14

    • Create activity fingerprints using multiple metal substrates

    • Use statistical approaches (principal component analysis) to distinguish activity patterns

  • Inhibitor Sensitivity:

    • Screen for selective inhibitors that affect AIM14 but not other metalloreductases

    • Develop inhibition profiles using concentration gradients

    • Use competitive and non-competitive inhibitors to distinguish kinetic patterns

  • Genetic Approaches:

    • Create knockout/knockdown strains lacking AIM14

    • Compare metalloreductase activity profiles between wild-type and modified strains

    • Complement with controlled expression of wild-type or mutant AIM14

  • Mass Spectrometry-Based Approaches:

    • Use activity-based protein profiling with MS detection

    • Quantify specific AIM14 peptides alongside activity measurements

    • Employ targeted proteomics to correlate protein abundance with activity

These approaches can be combined in a workflow that begins with genetic manipulation, followed by biochemical characterization and confirmation using multiple orthogonal methods.

How has the AIM14 gene evolved within the Lachancea genus compared to other yeast lineages?

The evolution of AIM14 within Lachancea should be considered in the context of this genus's evolutionary history. Lachancea diverged after the appearance of anaerobic capability, approximately 125-150 million years ago, prior to the whole-genome duplication event in the Saccharomyces lineage . This evolutionary positioning makes AIM14 particularly interesting for understanding early adaptations in yeast metabolism.

Evolutionary Patterns:

  • Phylogenetic Context:

    • Lachancea represents the first lineage after the loss of respiratory chain complex I

    • This event allowed the emergence of the long-term Crabtree effect and anaerobic growth capability

    • AIM14 likely evolved in this context of changing metabolic capabilities

  • Comparative Sequence Analysis:

    • AIM14 shows characteristic sequence signatures of the Lachancea clade

    • The gene likely underwent selection pressures different from those in post-whole genome duplication yeasts

    • Sequence conservation patterns may reveal functionally important domains

  • Genomic Context Conservation:

    • Analysis of synteny around the AIM14 locus (KLTH0H11550g) across species

    • Evaluation of regulatory element conservation

    • Identification of potential horizontal gene transfer events

  • Selection Pressure Analysis:

    • Calculation of dN/dS ratios to determine selection modes acting on AIM14

    • Comparison of these pressures across different yeast lineages

    • Identification of positions under positive selection

The high genetic diversity observed within L. thermotolerans (average pairwise difference between strains is 9.33e-3 bp-1) suggests that genes like AIM14 may show significant variation that reflects adaptation to different ecological niches.

What is the relationship between AIM14 function and the metabolic adaptations observed in L. thermotolerans strains from different environments?

L. thermotolerans shows clear signatures of adaptation to different environments, particularly anthropized niches like winemaking . The potential relationship between AIM14 function and these adaptations can be examined through several perspectives:

Metabolic Integration Analysis:

  • Metal-Dependent Pathways:

    • AIM14 may influence metal cofactor availability for key metabolic enzymes

    • The protein could be integrated with adaptations in carbon metabolism pathways

    • Changes in metal homeostasis might be coordinated with changing metabolic requirements

  • Stress Response Coordination:

    • Wine-related strains show increased fitness in the presence of ethanol and sulfites

    • AIM14 may contribute to metal-dependent stress response mechanisms

    • Coordinated regulation with other stress response genes might occur

  • Population Genomic Correlations:

    L. thermotolerans ClusterGenetic Diversity (π)Potential AIM14 Adaptation
    Wild strains4.15e-3 bp-1Higher sequence variation, possibly diverse functions
    Anthropized strains1.62e-3 bp-1Lower diversity, potential functional specialization
    Europe-mix (wine-related)IntermediateLikely adaptations to fermentation environment
  • Gene Content Variations:

    • Significant differences in gene content between clusters are observed in L. thermotolerans

    • AIM14 might show copy number variations similar to those observed in MAL1 and DAL5 genes

    • These variations could correlate with metabolic adaptations to specific environments

Experimental approaches combining comparative genomics, transcriptomics under different growth conditions, and functional characterization of AIM14 variants would help elucidate these relationships.

What emerging technologies could advance our understanding of L. thermotolerans AIM14 structure and function?

Several cutting-edge technologies show promise for deepening our understanding of AIM14:

  • Cryo-Electron Microscopy:

    • High-resolution structural determination of membrane-associated proteins like AIM14

    • Visualization of metal binding sites and conformational changes during catalysis

    • Structural comparison with homologous metalloreductases

  • AlphaFold2 and Protein Structure Prediction:

    • Generation of accurate structural models to guide experimental design

    • Prediction of protein-protein and protein-metal interactions

    • Identification of potential allosteric sites

  • Single-Cell Omics:

    • Analysis of AIM14 expression heterogeneity within yeast populations

    • Correlation of expression patterns with cell-to-cell phenotypic differences

    • Identification of regulatory networks controlling AIM14 expression

  • Genome-Wide CRISPR Screens:

    • Identification of genetic interactions with AIM14

    • Discovery of synthetic lethal relationships in different metal stress conditions

    • Mapping of functional pathways connected to metalloreduction activity

  • Nanoscale Secondary Ion Mass Spectrometry (NanoSIMS):

    • Visualization of metal ion distribution within cells

    • Correlation of AIM14 localization with metal homeostasis

    • Analysis of metal flux changes in AIM14 mutants

Integration of these technologies would provide a comprehensive understanding of AIM14's role in L. thermotolerans biology and potentially reveal novel applications in biotechnology.

How might AIM14 research contribute to our broader understanding of yeast adaptation and domestication processes?

Research on L. thermotolerans AIM14 has the potential to provide significant insights into fundamental aspects of yeast evolution and adaptation:

  • Pre- vs. Post-Whole Genome Duplication Adaptations:

    • AIM14 exists in a lineage that diverged before the whole genome duplication event

    • Comparison with Saccharomyces metalloreductases could reveal how duplication events influence functional specialization

    • Analysis could provide insights into the evolution of metal homeostasis systems across yeast phylogeny

  • Anthropization Signatures:

    • L. thermotolerans shows clear signatures of adaptation to human-associated environments

    • AIM14 variants may exhibit specific changes related to this anthropization process

    • These adaptations could represent convergent evolution with other domesticated yeasts

  • Metabolic Evolution Models:

    • L. thermotolerans represents the first lineage after the loss of respiratory chain complex I

    • AIM14 function may be linked to adaptations following this critical evolutionary event

    • Understanding these connections could provide insights into early evolution of fermentative metabolism

  • Climate Change Adaptation Research:

    • L. thermotolerans has applications in addressing climate change effects on winemaking

    • AIM14's role in stress responses may inform breeding strategies for climate-resilient yeast strains

    • Research could provide models for predicting adaptation potential in changing environments

Systematic comparative studies of AIM14 across diverse L. thermotolerans strains and related species, combined with detailed phenotypic characterization, would significantly advance our understanding of these broader evolutionary questions.

Acknowledgments

This FAQ collection was compiled based on the latest available research data on Lachancea thermotolerans and the AIM14 metalloreductase. The information presented integrates genomic, biochemical, and evolutionary perspectives to provide comprehensive guidance for researchers working with this protein system.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.