Recombinant Lachancea thermotolerans Protein SEY1 (SEY1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to customer specifications.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
SEY1; KLTH0C10230g; Protein SEY1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-783
Protein Length
full length protein
Species
Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) (Yeast) (Kluyveromyces thermotolerans)
Target Names
SEY1
Target Protein Sequence
MGETEEAIQLINEEKEFNSSTLQYFQKCVKERDVGVDYHVISVFGSQSSGKSTLLNALFH TQFDTMNAKVKRQQTTKGIWLGHTTRIATLENSLTPVKDLFVLDVEGSDGAERGEDQDFE RKAALFAIAISEVLIVNMWEQQVGLYQGNNMALLKTVFEVNLSLFGHQNDHKVLLLFVIR DHVGVTPLSSLQETLEAELNAIWSDLAKPEGCENSSLYDFFDLKFTALAHKVLQPDLFME NVKELGNKFSSETPGKSFFKPEYHHNLPLDGWTMYAGNCWNQIETNKDLDLPTQQILVAK FKTEEISNQALALLLENYPVDLHCRELSDLAGKLQELKSLCLQEYDTYASRYAKPVYMDN RRDLSHKIENKFKETISKFLDVQKEDLLSQVEKDLTERSRSTPFVTKMKEARKKAFDAFE ELLLQFTKLELVASLSDENEAFSIALDEACSNQSRKQLKQSVNRISKSVSSGIKEDIFFL LAHPELDLWDKVMEKFNEIVSDSTERYAVDDEKFDFQVGLSEEENQKVYKKVRSNAWTNL YEFVHGYLNEDNVVSILRDRFENKFRYDEHDSPRLWRNEEEIDNAFRVAKEHALEVLNVL SLASNSDHVEIVPDVPLSSGLDDEELEGEYEDEEGIYHEKGFAHILTASQRERAVQKFKR QANTTVIEAKRSIIRTTTHIPLYVYALLVVLGWNEFMIVIRNPLFVTLLVILSVTAYFVH KLNLWAPILALVNSAVSETKALARNKLKVILDDDSSSSSKASKEPTEEYEMQDLAKSSTT GTG
Uniprot No.

Target Background

Function

SEY1 protein cooperates with reticulon proteins and the tubule-shaping DP1 family proteins to generate and maintain the structure of the tubular endoplasmic reticulum network. Its GTPase activity is essential for this function in ER organization.

Database Links
Protein Families
TRAFAC class dynamin-like GTPase superfamily, GB1/RHD3-type GTPase family, RHD3 subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Lachancea thermotolerans Protein SEY1 and what is its significance?

Lachancea thermotolerans Protein SEY1 (SEY1) is a full-length protein comprising 783 amino acids that can be recombinantly expressed with an N-terminal histidine tag . The protein is identified by the accession number C5DEL5 and is derived from Lachancea thermotolerans, a non-conventional yeast species that diverged from Saccharomyces cerevisiae prior to the whole genome duplication event .

While specific SEY1 functions aren't fully detailed in current literature, its significance lies in understanding non-conventional yeast biology and potential applications in high-temperature biofermentation processes. L. thermotolerans has shown promise in thermotolerance research, with experimentally evolved strains demonstrating growth at temperatures up to 37°C and improved fermentative capabilities . As a full-length protein retained across evolution, SEY1 likely plays important roles in cellular processes that may contribute to these thermotolerance characteristics.

What expression systems are available for recombinant SEY1 production?

Multiple expression systems are viable for recombinant SEY1 production, each offering distinct advantages depending on research objectives:

  • E. coli expression systems: Provide excellent yields and shorter turnaround times, making them ideal for initial structural studies and when post-translational modifications are not critical . The documented success with N-terminal His-tagging in E. coli suggests this system is readily optimizable for SEY1 .

  • Yeast expression systems: Offer good yields with faster turnaround times compared to higher eukaryotic systems while providing eukaryotic post-translational modifications that may be important for SEY1 function . These systems could be particularly relevant when studying SEY1 in a context more similar to its native environment.

  • Insect cell/baculovirus systems: Provide more complex post-translational modifications that may be necessary for correct protein folding or retention of specific activities . This system represents a middle ground between simpler prokaryotic systems and more complex mammalian expression.

  • Mammalian cell expression: Offers the most comprehensive post-translational modifications, potentially crucial if SEY1 requires complex glycosylation or other mammalian-specific modifications to maintain native functionality .

The selection of expression system should be guided by specific research questions, with E. coli and yeast systems being preferred for initial characterization due to their efficiency and reasonable yield-to-effort ratio .

What are the optimal storage conditions for recombinant SEY1 protein?

The optimal storage conditions for recombinant Lachancea thermotolerans Protein SEY1 require careful consideration to maintain structural integrity and functional activity. Based on established protocols, the following storage parameters are recommended:

  • Long-term storage: Store at -20°C to -80°C, with the latter preferred for extended preservation periods . This temperature range minimizes degradation by proteases and prevents structural changes that could affect functional studies.

  • Buffer composition: A Tris/PBS-based buffer with 6% Trehalose at pH 8.0 has been demonstrated to maintain protein stability . Trehalose acts as a cryoprotectant and stabilizes protein structure during freeze-thaw cycles.

  • Aliquoting strategy: Upon initial reconstitution, immediately divide the protein solution into single-use aliquots to avoid repeated freeze-thaw cycles . This practice significantly reduces activity loss and structural degradation over time.

  • Working stock handling: For ongoing experiments, working aliquots can be maintained at 4°C for up to one week, though activity should be verified periodically .

  • Glycerol addition: Addition of glycerol to a final concentration of 5-50% (with 50% being standard) before aliquoting and freezing provides further protection against freeze-damage .

These storage protocols align with best practices for recombinant proteins, ensuring maximum retention of SEY1's structural and functional properties during experimental timeframes.

How can I reconstitute lyophilized SEY1 protein for experimental use?

Proper reconstitution of lyophilized SEY1 protein is critical for maintaining its structural integrity and functional properties. The following methodological approach is recommended:

  • Pre-reconstitution preparation: Briefly centrifuge the protein vial prior to opening to ensure all lyophilized material is collected at the bottom, preventing product loss during the opening process .

  • Reconstitution solution: Use deionized sterile water to reconstitute the protein to a concentration between 0.1-1.0 mg/mL . This concentration range optimizes solubility while maintaining protein stability.

  • Solubilization technique:

    • Add reconstitution solution slowly down the side of the vial

    • Gently rotate the vial to ensure complete dissolution

    • Avoid vigorous shaking or vortexing which can cause protein denaturation through mechanical stress

    • Allow the solution to stand at room temperature for 10-15 minutes to ensure complete rehydration

  • Post-reconstitution processing: After complete dissolution, add glycerol to a final concentration of 5-50% (with 50% being standard) for cryoprotection if the protein will be stored frozen .

  • Quality control: After reconstitution, verify protein concentration using standard quantification methods (Bradford, BCA, or spectrophotometric measurement at A280) and assess activity with appropriate functional assays before proceeding with experiments.

  • Working solution preparation: If concentrated stock solutions are prepared, dilute to working concentrations using buffers optimized for the specific experimental applications.

This systematic approach to reconstitution ensures maximum recovery of functional SEY1 protein from the lyophilized state while minimizing potential degradation or activity loss.

What experimental approaches can be used to study SEY1 function in thermotolerance mechanisms?

Investigating SEY1 function in thermotolerance mechanisms requires a multi-faceted experimental approach that combines molecular, cellular, and systems biology techniques:

  • Gene knockout/knockdown studies:

    • CRISPR-Cas9 mediated deletion of SEY1 in L. thermotolerans

    • Analysis of resulting phenotypes at various temperatures (30°C, 35°C, 37°C)

    • Complementation with wild-type and mutant SEY1 variants to confirm specificity

    • Quantification of growth rates, lag phases, and maximum cell densities across temperature gradients

  • Protein-protein interaction mapping:

    • Immunoprecipitation coupled with mass spectrometry to identify SEY1 interaction partners

    • Yeast two-hybrid screening against a L. thermotolerans library

    • Bimolecular fluorescence complementation to validate interactions in vivo

    • Co-evolution analysis with potential interacting proteins across thermotolerant yeast species

  • Structural biology approaches:

    • X-ray crystallography or cryo-EM to determine SEY1 structure at different temperatures

    • Hydrogen-deuterium exchange mass spectrometry to identify temperature-sensitive regions

    • Circular dichroism spectroscopy to assess secondary structure changes under thermal stress

  • Systems biology integration:

    • RNA-Seq analysis comparing wild-type and SEY1-mutant strains at different temperatures

    • Proteomics profiling to identify differential protein expression in response to SEY1 perturbation

    • Metabolomics analysis to connect SEY1 function to broader cellular processes

  • Evolutionary experimental approaches:

    • Directed evolution of SEY1 under increasing temperature selection

    • Co-culture experiments with bacteria to mimic the successful approach demonstrated with L. thermotolerans

    • Comparative analysis of SEY1 sequences and functions across yeast species with varying thermotolerance

These methodologies collectively would provide comprehensive insights into SEY1's role in thermotolerance mechanisms, particularly when analyzed in conjunction with the experimental evolution approaches that have already demonstrated success in improving L. thermotolerans thermotolerance .

How can I design experiments to assess SEY1 thermotolerance properties?

Designing robust experiments to assess SEY1's contribution to thermotolerance requires careful consideration of experimental variables, controls, and analytical approaches:

  • Experimental design framework:

    • Begin with a specific, testable hypothesis about SEY1's role in thermotolerance

    • Clearly define independent variables (temperature, SEY1 expression levels) and dependent variables (growth rates, survival percentages, protein activity)

    • Identify potential confounding variables (media composition, cell density, growth phase) and control for them

    • Implement both between-subjects designs (comparing different strains) and within-subjects designs (measuring the same strain under different conditions)

  • Thermal gradient analysis:

    • Establish a precise thermal gradient system (30-40°C in 1°C increments)

    • Monitor growth parameters (OD600, colony-forming units) at defined time points

    • Calculate thermal death points and thermal death times for wild-type vs. SEY1-modified strains

    • Implement standard microbiological techniques with appropriate controls

  • Molecular thermostability assays:

    • Perform thermal shift assays using purified SEY1 protein to determine melting temperature (Tm)

    • Compare wild-type SEY1 with site-directed mutants to identify critical residues

    • Utilize differential scanning calorimetry to quantify thermodynamic parameters

    • Implement activity assays at various temperatures to correlate structural stability with function

  • Cellular stress response integration:

    • Monitor heat shock protein expression in relation to SEY1 activity

    • Assess membrane fluidity changes using fluorescent probes

    • Quantify reactive oxygen species production under thermal stress

    • Evaluate mitochondrial function in SEY1 wild-type vs. mutant strains

  • Experimental evolution approach:

    • Design serial passage experiments under increasing temperature selection

    • Implement bacterial co-culture methods similar to those that successfully improved L. thermotolerans thermotolerance

    • Sequence evolved strains to identify mutations in SEY1 and related genes

    • Perform functional confirmation of identified mutations through site-directed mutagenesis

This experimental design framework provides a comprehensive approach to evaluating SEY1's thermotolerance properties while adhering to sound scientific methodology and controlling for variables that could confound results interpretation .

What methods can be used to analyze potential contradictions in SEY1 research data?

Addressing contradictions in SEY1 research data requires robust analytical frameworks that can reconcile seemingly conflicting results:

How does bacterial co-culture affect SEY1 expression in L. thermotolerans?

The effect of bacterial co-culture on SEY1 expression in L. thermotolerans represents an intriguing research direction, especially considering the demonstrated success of bacterial co-culture in improving thermotolerance in this yeast . While direct data on SEY1 expression changes is not explicitly provided in the available literature, we can outline a methodological framework for investigating this question:

  • Co-culture experimental design:

    • Implement sequential co-culture with six bacterial species of increasing ethanol tolerance, following the protocol that successfully improved L. thermotolerans thermotolerance

    • Establish appropriate controls including L. thermotolerans monoculture under identical conditions

    • Create time-course experiments to capture dynamic changes in SEY1 expression during adaptation

    • Include diverse bacterial species to identify specific microbial interactions that most significantly affect SEY1

  • SEY1 expression quantification methods:

    • Implement RT-qPCR to measure SEY1 mRNA levels during co-culture adaptation

    • Develop Western blot protocols with anti-SEY1 antibodies to quantify protein levels

    • Create SEY1-reporter fusions (e.g., GFP) to monitor expression in real-time during co-culture

    • Perform ribosome profiling to assess translational efficiency of SEY1 mRNA

  • Multi-omics integration approach:

    • Conduct RNA-Seq analysis comparing monoculture vs. co-culture conditions at different time points

    • Apply proteomics to identify post-translational modifications of SEY1 induced by bacterial presence

    • Implement ChIP-Seq to examine changes in transcription factor binding at the SEY1 promoter

    • Analyze metabolomic profiles to identify bacterial metabolites that might regulate SEY1 expression

  • Mechanistic investigation:

    • Test hypotheses about bacterial signaling molecules that might influence SEY1 expression

    • Examine stress response pathways activated during co-culture that could regulate SEY1

    • Investigate epigenetic modifications that might stably alter SEY1 expression patterns

    • Develop genetic screens to identify bacterial genes necessary for SEY1 expression changes

The experimental evolution approach that subjected L. thermotolerans to sequential co-culture with bacteria resulted in strains with improved thermotolerance and fermentative capabilities . This suggests that bacterial interactions likely trigger adaptive responses in multiple yeast pathways, potentially including SEY1-related functions. The methodological framework outlined above would systematically explore these interactions, providing insights into how bacterial co-culture shapes SEY1 expression and contributes to enhanced thermotolerance.

What purification techniques are most effective for SEY1 protein?

The effective purification of recombinant SEY1 protein requires a systematic approach that accounts for its specific physicochemical properties and expression system characteristics. While the optimal protocol may require empirical optimization, the following methodological framework represents best practices for SEY1 purification:

  • Affinity chromatography (primary purification):

    • For His-tagged SEY1 expressed in E. coli , immobilized metal affinity chromatography (IMAC) using Ni-NTA or Co-NTA resins represents the ideal first purification step

    • Optimization parameters include:

      • Imidazole concentration in binding buffer (typically 10-20 mM to reduce non-specific binding)

      • Imidazole gradient for elution (typically 50-300 mM)

      • Flow rate adjustment to maximize binding efficiency

      • Sample loading density to prevent column saturation

  • Ion exchange chromatography (secondary purification):

    • Based on SEY1's theoretical isoelectric point, select appropriate ion exchange media

    • Anion exchange (Q-Sepharose) at pH above pI or cation exchange (SP-Sepharose) at pH below pI

    • Optimize salt gradient (typically 0-1M NaCl) for selective elution of SEY1

    • Consider buffer systems that maintain optimal pH for SEY1 stability

  • Size exclusion chromatography (polishing step):

    • Select appropriate matrix based on SEY1's molecular weight (approximately 87 kDa for the 783 amino acid protein)

    • Optimize flow rate to balance resolution against time

    • Analyze elution profile to assess oligomeric state and homogeneity

    • Consider including reducing agents if disulfide-mediated aggregation occurs

  • Alternative purification strategies:

    • For non-His-tagged variants, consider glutathione-S-transferase (GST) or maltose-binding protein (MBP) fusion systems

    • For challenging preparations, explore on-column refolding protocols during affinity purification

    • If inclusion bodies form, develop solubilization and refolding protocols using chaotropic agents

  • Quality control metrics:

    • SDS-PAGE analysis to confirm >90% purity

    • Western blot verification of intact SEY1

    • Activity assays to confirm functional integrity

    • Dynamic light scattering to assess monodispersity

These methodological approaches provide a comprehensive framework for SEY1 purification, with the specific protocol requiring optimization based on expression system and research requirements. For SEY1 expressed in E. coli with an N-terminal His tag, affinity chromatography followed by polishing steps has been successfully implemented to achieve >90% purity .

How can I validate the structure and function of recombinant SEY1?

Validating the structure and function of recombinant SEY1 requires a multi-faceted approach that confirms both proper folding and biological activity:

  • Structural validation techniques:

    • Circular dichroism (CD) spectroscopy: Assess secondary structure composition (α-helices, β-sheets) and compare with theoretical predictions from sequence analysis

    • Fourier-transform infrared spectroscopy (FTIR): Provide complementary data on secondary structure elements

    • Thermal shift assays: Determine protein stability and folding integrity through melting temperature (Tm) analysis

    • Dynamic light scattering (DLS): Confirm sample monodispersity and appropriate hydrodynamic radius

    • Limited proteolysis: Probe tertiary structure through accessibility of protease cleavage sites

  • Higher-order structural analysis:

    • Small-angle X-ray scattering (SAXS): Obtain low-resolution structural information in solution

    • Cryo-electron microscopy: Visualize protein structure, particularly useful if SEY1 forms larger complexes

    • X-ray crystallography: Determine atomic-level structure if crystals can be obtained

    • Nuclear magnetic resonance (NMR): Analyze structure of specific domains if full-length protein is too large

  • Functional validation approaches:

    • ATPase activity assays: If SEY1 has predicted nucleotide-binding domains, measure ATP hydrolysis rates

    • Protein-protein interaction studies: Verify interactions with known binding partners using pull-down assays

    • Membrane binding assays: If SEY1 has predicted membrane association, confirm using liposome binding experiments

    • Complementation assays: Test if recombinant SEY1 can rescue phenotypes in SEY1-knockout cells

  • Comparative validation:

    • Homology-based predictions: Compare structure and function with homologous proteins of known function

    • Conservation analysis: Identify highly conserved residues likely essential for function

    • Species complementation: Test functional conservation across species boundaries

  • Quality control parameters:

    • Mass spectrometry: Confirm protein identity and integrity, identify post-translational modifications

    • Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS): Determine absolute molecular weight and oligomeric state

    • Thermostability analysis: Compare stability profiles at different temperatures to assess functional integrity under experimental conditions

This comprehensive validation framework ensures that recombinant SEY1 maintains native-like structure and function, critical for reliable experimental outcomes and valid data interpretation. The specific assays selected should align with SEY1's predicted functional properties and the research questions being addressed.

What controls should be included in SEY1 experimental designs?

Robust experimental design for SEY1 research requires careful implementation of appropriate controls to ensure valid and reproducible results. The following comprehensive control framework should be considered:

  • Protein-level controls:

    • Positive control: Well-characterized protein with similar size/properties to SEY1 processed identically

    • Negative control: Buffer-only or irrelevant protein samples to identify non-specific effects

    • Denatured SEY1: Heat-denatured or chemically denatured SEY1 to distinguish structure-dependent functions

    • Tagged protein control: If using His-tagged SEY1 , include a different His-tagged protein to control for tag effects

    • Concentration gradient: Series of SEY1 concentrations to establish dose-dependency of observed effects

  • Experimental technique controls:

    • Standard curves: For quantitative assays, include standard curves with known quantities of reference materials

    • Technical replicates: Minimum of three replicates to account for measurement variability

    • Biological replicates: Independent protein preparations to account for batch-to-batch variation

    • Time-course measurements: Multiple time points to distinguish kinetic differences

    • Environmental controls: Temperature, pH, and buffer consistency monitoring throughout experiments

  • Genetic and cellular controls:

    • Wild-type cells: Unmodified L. thermotolerans strains as baseline comparisons

    • SEY1 knockout: Complete deletion strains to assess loss-of-function effects

    • Complementation control: SEY1 knockout complemented with wild-type SEY1 to confirm specificity

    • Point mutant controls: Strategically designed SEY1 mutants targeting predicted functional domains

    • Vector control: Empty vector transformants to control for transformation effects

  • Thermotolerance-specific controls:

    • Temperature gradient: Multiple defined temperature points to establish precise thermal response profiles

    • Known thermotolerant strain: Positive control strain with established thermotolerance properties

    • Co-culture controls: For bacterial co-culture experiments, include bacteria-only and yeast-only controls

    • Mixed population controls: Labeled wild-type and experimental strains grown together to control for environmental variation

  • Statistical and experimental design controls:

    • Randomization: Random assignment of samples to experimental groups to minimize bias

    • Blinding: Researcher blinding during data collection and analysis to prevent confirmation bias

    • Power analysis: Pre-experimental calculations to ensure sufficient sample sizes for detecting effects

    • Regression to the mean controls: When selecting extreme phenotypes, control for natural statistical regression

This comprehensive control framework adheres to principles of sound experimental design while addressing the specific challenges of SEY1 research. By systematically implementing these controls, researchers can minimize confounding factors, reduce experimental artifacts, and produce more reliable and reproducible results.

How should I interpret conflicting results in SEY1 research?

Interpreting conflicting results in SEY1 research requires a systematic analytical approach that moves beyond simply identifying contradictions to understanding their underlying causes. The following methodological framework provides a structured approach to resolving such conflicts:

  • Contradiction classification and categorization:

    • Classify contradiction types: Determine if conflicts represent true contradictions, partial disagreements, or contextual differences

    • Categorize by research domain: Group contradictions by experimental approach, methodology, or specific SEY1 function being investigated

    • Evaluate contradiction severity: Assess whether conflicts represent fundamental disagreements about core SEY1 properties or peripheral aspects

    • Apply ontology-driven approaches: Use structured knowledge frameworks to systematically identify and categorize contradictory findings

  • Methodological reconciliation approach:

    • Comparative methods analysis: Create detailed tables comparing experimental protocols across contradictory studies:

      • Expression systems used (E. coli vs. yeast expression)

      • Protein preparation differences (tags, purification methods)

      • Assay conditions (temperature, pH, buffer composition)

      • L. thermotolerans strain variations (particularly relevant for thermotolerance studies)

    • Identify critical methodological variables: Determine which protocol differences most likely explain divergent results

    • Design validation experiments: Create targeted experiments that specifically address methodological differences

  • Contextual interpretation framework:

    • Strain-specific analysis: Determine if contradictions result from genetic differences between L. thermotolerans strains

    • Condition-dependent effects: Assess if SEY1 exhibits context-dependent functions that explain apparent contradictions

    • Evolutionary considerations: Evaluate if SEY1 function has evolved differently across strains due to selective pressures

    • Apply machine learning approaches: Utilize computational methods to identify patterns across seemingly contradictory datasets

  • Statistical meta-analytical approach:

    • Quantitative meta-analysis: For studies with comparable quantitative outcomes, perform formal meta-analysis

    • Effect size comparison: Focus on magnitude and direction of effects rather than binary significance

    • Heterogeneity assessment: Quantify between-study variability (I² statistic) and explore its sources

    • Publication bias evaluation: Assess if contradictions might result from publication bias (e.g., funnel plot analysis)

  • Integration and synthesis strategy:

    • Develop integrative models: Create theoretical frameworks that can accommodate seemingly contradictory findings

    • Weight evidence quality: Prioritize results from studies with robust methods and appropriate controls

    • Biological plausibility assessment: Evaluate conflicting results against established principles in protein biology

    • Research community engagement: Collaborate with other SEY1 researchers to resolve contradictions through coordinated efforts

This methodological framework provides researchers with systematic tools for interpreting conflicting SEY1 results while avoiding common cognitive biases that can hinder scientific progress. By applying contradiction detection approaches and rigorous comparative analysis, researchers can transform apparent conflicts into opportunities for deeper mechanistic understanding.

How can I compare SEY1 with homologous proteins from other organisms?

Comparative analysis of SEY1 with homologous proteins from other organisms requires a multi-disciplinary approach combining bioinformatics, structural biology, and functional genomics. The following methodological framework provides a comprehensive strategy:

  • Sequence-based comparative analysis:

    • Homology identification: Employ iterative sequence search algorithms (PSI-BLAST, HMMER) to identify SEY1 homologs across taxonomic groups

    • Multiple sequence alignment: Generate alignments using MAFFT, T-Coffee, or MUSCLE with manual curation of alignment quality

    • Conservation analysis: Calculate per-residue conservation scores to identify functionally critical regions

    • Phylogenetic reconstruction: Build maximum likelihood or Bayesian phylogenetic trees to understand evolutionary relationships

    • Domain architecture comparison: Analyze domain composition and arrangement across homologs using SMART, Pfam, or InterPro

  • Structural comparative methodology:

    • Homology modeling: Generate structural models of SEY1 based on experimentally determined structures of homologs

    • Structural alignment: Superimpose SEY1 models with homologous structures to identify conserved structural features

    • Binding site analysis: Compare predicted ligand binding sites across homologs

    • Electrostatic surface comparison: Analyze conservation of surface charge distribution

    • Molecular dynamics simulations: Compare conformational dynamics of SEY1 with homologs under varying conditions

  • Functional comparative approaches:

    • Cross-species complementation: Test functional interchangeability through heterologous expression

    • Comparative biochemical assays: Measure enzymatic parameters (Km, kcat, substrate specificity) across homologs

    • Interactome comparison: Identify conservation of protein-protein interaction networks

    • Expression pattern analysis: Compare tissue/condition-specific expression profiles of homologs

    • Subcellular localization comparison: Determine conservation of cellular compartmentalization

  • Evolutionary analysis methodology:

    • Selection pressure analysis: Calculate dN/dS ratios to identify sites under positive or purifying selection

    • Ancestral sequence reconstruction: Infer ancestral SEY1 sequences to understand functional evolution

    • Coevolution analysis: Identify co-evolving residues that maintain functional interactions

    • Evolutionary rate comparison: Analyze relative evolutionary rates of different protein domains

  • Integrated comparative data presentation:

    • Sequence-structure-function mapping: Create visualizations that integrate multiple levels of comparative data

    • Taxonomic distribution heatmaps: Visualize conservation patterns across taxonomic groups

    • Interactive phylogenetic trees: Annotate with functional and structural data

    • Comparative data tables: Systematically organize key parameters across homologs:

SpeciesProtein IDSequence Identity (%)Structural RMSD (Å)Complementation EfficiencyTemperature Optimum (°C)Key Functional Differences
L. thermotoleransSEY1 100N/AN/A35-37 Reference sequence
S. cerevisiaeSey1p~70*~2.0*High*30-33*Lower thermostability*
Schizosaccharomyces pombeSey1 homolog~60*~2.5*Moderate*30-32*Altered substrate specificity*
Candida albicansSey1 homolog~65*~2.3*Moderate*37*Pathogenicity-associated functions*

*Note: These values are hypothetical examples for illustrative purposes based on typical relationships between homologous proteins. Actual values would require experimental determination.

This comprehensive comparative framework enables researchers to position SEY1 within its evolutionary context, gaining insights into both conserved functions and species-specific adaptations that may contribute to L. thermotolerans' unique thermotolerance properties .

What are the key methodological considerations for researchers working with SEY1?

Effective research on Recombinant Lachancea thermotolerans Protein SEY1 requires meticulous attention to methodological details across multiple experimental domains. Researchers should prioritize the following key considerations to ensure reliable, reproducible, and meaningful results:

  • Expression and purification optimization: The choice of expression system significantly impacts SEY1 yield and functionality, with E. coli and yeast systems offering the best balance of yield and processing time . When using E. coli, N-terminal His-tagging has proven effective for purification via affinity chromatography . Regardless of the expression system selected, researchers must carefully optimize purification protocols to achieve >90% purity while maintaining structural integrity .

  • Storage and handling protocols: SEY1 stability requires careful attention to storage conditions, with optimal preservation achieved through storage at -20°C to -80°C in Tris/PBS-based buffer containing 6% trehalose at pH 8.0 . Researchers should implement strict aliquoting strategies to avoid repeated freeze-thaw cycles and consider adding glycerol to a final concentration of 50% for cryoprotection . These handling protocols directly impact experimental reproducibility and should be standardized across research groups.

  • Experimental design rigor: Studies involving SEY1 must adhere to fundamental principles of sound experimental design, including clearly defined variables, appropriate controls, and randomization . For thermotolerance experiments specifically, researchers should implement precise temperature control systems and include both positive and negative controls that establish clear baselines for comparison .

  • Contradiction resolution approach: When confronted with conflicting results, researchers should implement systematic contradiction detection methodologies and perform detailed comparative analyses of experimental protocols across studies. This approach transforms apparent contradictions into opportunities for mechanistic insights rather than obstacles to progress.

  • Evolutionary context integration: SEY1 research benefits significantly from comparative approaches that position findings within an evolutionary framework. By examining SEY1 alongside homologs from species with varying thermotolerance properties, researchers can identify conserved functional domains and species-specific adaptations that contribute to L. thermotolerans' unique characteristics .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.