Recombinant Lachancea thermotolerans Vacuolar membrane protein KLTH0G09570g (KLTH0G09570g)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Lachancea thermotolerans Vacuolar membrane protein KLTH0G09570g (KLTH0G09570g) is a protein derived from the yeast species Lachancea thermotolerans (formerly Kluyveromyces thermotolerans) . L. thermotolerans is known for its biotechnological potential and is found in various natural and human-related environments . The protein, designated as KLTH0G09570g, is a vacuolar membrane protein, suggesting it is located in the vacuolar membrane of the yeast cell .

Properties

  • Molecular Weight: The molecular weight of the protein is approximately 32,462 Da .

  • Source: The protein is produced in E. coli, Yeast, Baculovirus or Mammalian Cell .

  • Purity: Typically has a purity equal to or greater than 85% as determined by SDS-PAGE .

  • Form: Available in lyophilized or liquid form .

  • Tag Information: Contains an N-terminal tag and may also contain a C-terminal tag .

  • Storage: Recommended storage is at -20°C, with extended storage at -20°C or -80°C .

  • Shelf life: The shelf life of liquid form is generally 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C .

Function and Location

KLTH0G09570g is a vacuolar membrane protein, which, by similarity, belongs to the PRM5 family . Its subcellular location is the vacuole membrane, where it functions as a single-pass membrane protein .

Applications and Research

Lachancea thermotolerans has remarkable, yet underexplored, biotechnological potential . The yeast is used to produce high levels of lactic acid during alcoholic fermentation and gives winemakers new possibilities to naturally acidify red, white, and rosé wines during alcoholic fermentation .

Genetic Information

  • Gene Name: KLTH0G09570g

  • Chromosome Location: Chromosome G; NC_013083.1 (802806..803702, complement)

  • NCBI Gene ID: 8293726

  • NCBI Accession #: XP_002555448.1

  • UniProt Primary Accession #: C5DMK0

Lachancea thermotolerans in Winemaking

Lachancea thermotolerans is a non-Saccharomyces yeast with increasing interest in winemaking due to its ability to modulate wine acidity and aroma profiles .

  • Acid Production: L. thermotolerans produces lactic acid and consumes malic acid, contributing to the deacidification of musts and wines .

  • Flavor Profile: L. thermotolerans can influence the concentration of higher alcohols and esters, impacting the volatile profile of the wine .

  • Sequential Inoculation: L. thermotolerans is often used in sequential inoculation with Saccharomyces cerevisiae to manage acidity and complexity in wine .

Phenotypic Variability

Phenotyping assays reveal substantial variability in growth performance among different L. thermotolerans strains . Some strains exhibit lower growth on various substrates except glucose, while others show better growth on tested substrates . Certain groups display osmotolerance, while others show variable growth at different temperatures and on different carbon sources such as xylose and glycerol .

Availability

Recombinant Lachancea thermotolerans Vacuolar membrane protein KLTH0G09570g is available for purchase from various suppliers for research purposes . The protein can be produced in different hosts, including E. coli, yeast, baculovirus, and mammalian cells .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please specify it in your order for preferential development.
Synonyms
KLTH0G09570g; Vacuolar membrane protein KLTH0G09570g
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-298
Protein Length
full length protein
Species
Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) (Yeast) (Kluyveromyces thermotolerans)
Target Names
KLTH0G09570g
Target Protein Sequence
MVHQTDFISSTAILKTQKASTSLVHATMFERAMPSLTNAGKASSTKTYTTPTITPPSIKG NPHIWSSDKPSGTLFIAVGSVVGFIFLIIALAYIVSAYISRRQTEKLRFETIDQEFQSHV GGKSYSKLGNSDDPEKSGFLSKAVHTPQSRSVARLLDRPDFQQPSPALSNQDSSTSLAQE FYSSIRDQTAAQNRKSLFISPTVEIVNQQRKSAVLQNMNNSVSSLVSDSGAELNKPEKAA PSTRKAMYKARNKSSMGSAVGIAKSRSTSPVKSGLRDKPLDRAKTPSVYLDKMFEDES
Uniprot No.

Target Background

Database Links
Protein Families
PRM5 family
Subcellular Location
Vacuole membrane; Single-pass membrane protein.

Q&A

How should researchers properly store and reconstitute the recombinant protein for experimental use?

For optimal experimental outcomes, adhere to the following storage and reconstitution protocol:

  • Storage conditions: Store the lyophilized protein at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles .

  • Reconstitution procedure:

    • Briefly centrifuge the vial prior to opening to bring contents to the bottom

    • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C (50% glycerol is the default recommendation)

  • Working with reconstituted protein:

    • Store working aliquots at 4°C for up to one week

    • Avoid repeated freeze-thaw cycles as this can significantly reduce protein activity

What are the recommended protocols for expressing and purifying KLTH0G09570g protein for research applications?

Expression System Selection:

The most validated approach utilizes E. coli expression systems with the following considerations:

  • Vector design: Incorporate an N-terminal His-tag for simplified purification via affinity chromatography .

  • Expression optimization:

    • Monitor temperature, IPTG concentration, and induction time

    • Consider specialized E. coli strains optimized for membrane protein expression

    • Include protease inhibitors during cell lysis to prevent degradation

  • Purification workflow:

    • Immobilized metal affinity chromatography (IMAC) using the His-tag

    • Size exclusion chromatography for additional purification if needed

    • Buffer optimization to maintain protein stability throughout purification

  • Quality control:

    • SDS-PAGE analysis (target >90% purity)

    • Western blot confirmation

    • Mass spectrometry verification of intact protein

How can researchers effectively study KLTH0G09570g's role in cellular stress responses?

Based on research methodologies employed with L. thermotolerans, the following experimental approaches are recommended:

  • Synchrotron radiation-based FTIR (S-FTIR) microspectroscopy:

    • Allows analysis of single-cell biophysical profiles before and after stress conditions

    • Particularly valuable for studying membrane dynamics and protein structural changes

    • Enables assessment of protein conformational changes in the amide I (α-helix and β-sheet) and amide II regions

  • Complementary fluorescent probe techniques:

    • Stain cells with viability probes prior to stress exposure

    • Correlate spectroscopic data with viability assessments

  • Flow cytometry protocol:

    • Quantify cell viability under identical stress conditions

    • Enables statistical correlation between protein modifications and cellular outcomes

  • Controlled stress application:

    • Implement precise temperature and hydration gradients

    • Monitor protein response across different stress intensities

    • Compare KLTH0G09570g behavior to known stress-response proteins

How do structural modifications of KLTH0G09570g correlate with L. thermotolerans stress response patterns?

Research with L. thermotolerans has revealed significant correlations between protein structural modifications and cellular stress responses:

  • Membrane fluidity indicators:

    • Shift of symmetric C–H stretching vibration of the CH₂ group toward higher wavenumbers correlates with improved cell viability

    • This spectral signature appears to be a reliable predictor of membrane adaptability during stress

  • Protein structural dynamics:

    • Cells with reduced viability after dehydration demonstrate specific changes in:

      • α-helix and β-sheet regions (amide I band)

      • Amide II region

    • These changes serve as indicators of secondary protein structure disruption

  • Structure-function correlation approach:

    • Map specific protein regions to stress response functions

    • Analyze the amino acid composition of KLTH0G09570g for potential stress-responsive motifs

    • Consider targeted mutagenesis to identify critical functional domains

The following table summarizes key biophysical changes observed during stress responses that may involve KLTH0G09570g:

Spectral RegionMolecular AssignmentWavenumber (cm⁻¹)Correlation with Stress Response
Amide Iα-helix1650-1660Reduced intensity correlates with cell mortality
Amide Iβ-sheet1639Modifications indicate protein degradation
Amide IIN-H bending/C-N stretching1545Strong contribution in stressed cells
Lipid regionCH₂ symmetric stretchingHigher wavenumber shiftPositively correlates with improved viability

What are the critical considerations for designing experiments to investigate KLTH0G09570g's role in dehydration sensitivity?

L. thermotolerans demonstrates particular sensitivity to dehydration while maintaining resistance to freezing, suggesting complex membrane regulation mechanisms potentially involving KLTH0G09570g . Key experimental design considerations include:

  • Dehydration protocol optimization:

    • Temperature gradient control is crucial—higher temperatures (e.g., 60°C vs. 45°C) significantly reduce cell viability

    • Research indicates different dehydration kinetics (KA vs. KB) result in markedly different viability outcomes (<10% vs. 44% viability)

    • Control relative humidity (RH) precisely, as 23% RH at different temperatures produces significantly different mortality rates

  • Avoiding methodological artifacts:

    • Rehydration steps can introduce additional damage to cellular compartments

    • Lipolytic and proteolytic activities during extraction may result in loss of lipids and proteins

    • Direct analysis of dehydrated cells without rehydration is technically challenging but yields more accurate biophysical data

  • Multiparameter experimental design:

    • Systematically vary both temperature and hydration parameters

    • Include time-course analysis to capture dynamic responses

    • Compare wild-type responses to cells with modified KLTH0G09570g expression

How does the amino acid sequence of KLTH0G09570g suggest potential functional domains relevant to membrane dynamics?

Analysis of the 298 amino acid sequence reveals several notable features that may contribute to its functional role:

  • Hydrophobic transmembrane regions:

    • The sequence "TLFIAVGSVVGFIFLIIALAYIVSAYI" contains a high proportion of hydrophobic residues characteristic of membrane-spanning domains

    • These regions likely anchor the protein within the vacuolar membrane

  • Phosphorylation sites:

    • Several serine and threonine residues (particularly in the C-terminal region) represent potential regulatory phosphorylation sites

    • The sequence "SRSTSPVKS" contains a cluster of potential phosphorylation targets that may modulate protein function during stress

  • Charged residue distribution:

    • The protein contains relatively balanced acidic and basic residues

    • The C-terminal region "LDKMFEDES" contains alternating charged residues that may participate in ionic interactions

  • Comparative analysis approach:

    • Alignment with homologous proteins from related species could identify conserved domains

    • Structural modeling based on known vacuolar membrane proteins may reveal functional insights

What are common challenges in working with recombinant KLTH0G09570g and how can they be addressed?

Membrane proteins present specific experimental challenges that require strategic approaches:

  • Protein solubility issues:

    • Challenge: Hydrophobic domains can cause aggregation during expression and purification.

    • Solution: Evaluate different detergents (CHAPS, DDM, OG) for optimal solubilization; consider fusion partners that enhance solubility.

  • Functional activity assessment:

    • Challenge: Maintaining native conformation in recombinant systems.

    • Solution: Develop activity assays specific to membrane dynamics; consider reconstitution into artificial membrane systems.

  • Storage stability:

    • Challenge: Protein degradation during storage.

    • Solution: Add 5-50% glycerol to storage buffer; maintain at -80°C; avoid repeated freeze-thaw cycles .

  • Expression yield optimization:

    • Challenge: Low expression levels common with membrane proteins.

    • Solution: Evaluate codon optimization; test multiple E. coli strains; consider alternate expression systems (yeast, insect cells).

How might KLTH0G09570g research contribute to understanding broader mechanisms of cellular stress adaptation?

The study of KLTH0G09570g offers several promising avenues for understanding fundamental cellular adaptation mechanisms:

  • Comparative stress physiology:

    • L. thermotolerans demonstrates the interesting phenotype of high freezing resistance coupled with dehydration sensitivity

    • Understanding KLTH0G09570g's role may reveal how different stress response pathways are coordinated or antagonistic

  • Biotechnological applications:

    • L. thermotolerans has significant applications in food and beverage production including:

      • High lactic acid content beverages

      • Bio-sorption of ochratoxin A in wines

      • Development of unique sensorial profiles in fermented products

    • KLTH0G09570g research may reveal molecular targets to enhance these valuable traits

  • Membrane biophysics advancements:

    • Research shows membrane fluidity correlates with stress survival

    • Investigation of KLTH0G09570g's impact on membrane properties may reveal fundamental principles of cellular membrane dynamics

  • Methodological innovations:

    • Single-cell analysis approaches like S-FTIR microspectroscopy provide unprecedented insights into individual cell responses

    • Further development of these techniques using KLTH0G09570g as a model system could advance broader cellular analysis methods

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.