Recombinant Lachesis muta muta Cytochrome b (MT-CYB)

Shipped with Ice Packs
In Stock

Description

Production Systems

Host SystemYieldTurnaround TimePost-Translational Modifications
E. coliHighShortLimited (no glycosylation)
YeastHighModerateBasic eukaryotic modifications
Insect CellsMediumLongAdvanced modifications
MammalianLowVery LongHuman-like modifications

Data compiled from expression optimization studies .

Key Applications in Research

Biochemical studies:

  • Functional analysis of Complex III inhibitors (e.g., antimycin A)

  • Structure-function relationship studies of cytochrome b mutations

Disease modeling:

  • Investigating mitochondrial disorders linked to MT-CYB mutations:

    • MELAS-like syndromes

    • Dilated cardiomyopathy (e.g., m.14757T>C variant)

    • Exercise intolerance syndromes

Drug development:

  • Target validation for mitochondrial enhancers

  • Antibody production (e.g., Proteintech 55090-1-AP validated in WB/IF)

Quality Control Metrics

Purity:

  • 90% by SDS-PAGE

Validation assays:

  • Western blot with anti-CYTB antibodies

  • Functional assays measuring ubiquinol-cytochrome c reductase activity

Mutation Analysis Relevance

Novel pathogenic variants in MT-CYB (e.g., m.14864T>C, m.14757T>C) demonstrate:

  • Heteroplasmy levels correlating with clinical severity (32-57% in blood/urine/muscle)

  • Disruption of conserved residues (C40R, M4T) impacting proton transfer efficiency

  • Complex III activity reductions (30-70% in patient tissues)

Research Limitations

  • No crystallography data available for snake-derived MT-CYB

  • Functional differences between human and snake orthologs require characterization

  • Limited in vivo studies using recombinant Lachesis protein

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, should you have specific format requirements, kindly indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery times may vary based on the purchasing method and location. For precise delivery estimations, please consult your local distributors.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend brief centrifugation of the vial to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors including storage state, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. To maintain product integrity, avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is defined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
MT-CYB; COB; CYTB; MTCYB; Cytochrome b; Complex III subunit 3; Complex III subunit III; Cytochrome b-c1 complex subunit 3; Ubiquinol-cytochrome-c reductase complex cytochrome b subunit; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-214
Protein Length
full length protein
Species
Lachesis muta muta (Bushmaster)
Target Names
Target Protein Sequence
YINYKNMLHQHMLTLFNLLPVGSNISTWWNFGSMLLICLMIQTTTGFFLAIHYTANINLA FSSIMHISRDVPYGWIMQNTHAIGASLFFICIYTHIARGIYYGSYLNKEVWLSGTTLLII LMATAFFGYVLPWGQMSFWAATVITNLLTAIPYLGNTLTTWLWGGFAINDPTLTRFFALH FILPFAIISLSSIHILLLHNEGSNNPLGTNSDID
Uniprot No.

Target Background

Function
Cytochrome b, a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), plays a crucial role in the mitochondrial respiratory chain. The b-c1 complex facilitates electron transfer from ubiquinol to cytochrome c. This process contributes to the generation of a proton gradient across the mitochondrial membrane, which is subsequently used for ATP synthesis.
Protein Families
Cytochrome b family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Lachesis muta muta Cytochrome b (MT-CYB) and why is it significant in research?

MT-CYB is a mitochondrially encoded protein that forms part of the respiratory chain complex III. In Lachesis muta muta (South American bushmaster snake), this protein has gained research interest both as a mitochondrial marker for evolutionary studies and for understanding nuclear-mitochondrial interactions. MT-CYB is significant because recent research has demonstrated that mitochondrial RNAs, including MT-CYB, can localize to the nucleus and potentially regulate nuclear transcription, forming mitochondrial-chromatin attachment RNAs (mt-caRNAs) . Additionally, mutations in human MT-CYB have been associated with various pathologies including mitochondrial myopathy and MELAS syndrome .

How can researchers verify the authenticity of recombinant MT-CYB?

Verification of recombinant MT-CYB requires a multi-faceted approach:

  • Sequence verification: Confirm the sequence using both DNA sequencing of the expression construct and protein sequencing techniques.

  • Mass spectrometry analysis: Use LC-MS/MS to confirm the protein identity and detect any post-translational modifications.

  • Immunoblotting: Use specific antibodies against MT-CYB or epitope tags.

  • Functional assays: Assess electron transport capability in reconstituted systems.

  • Spectral characteristics: Analyze absorbance spectra at 550-560 nm to confirm proper heme incorporation.

Proper verification is crucial since contamination with nucleic acids or other mitochondrial proteins can significantly impact experimental outcomes, particularly when studying nuclear localization phenomena.

What purification strategies are most effective for recombinant MT-CYB?

Purification of recombinant MT-CYB presents significant challenges due to its hydrophobic nature and membrane association. A successful purification strategy typically involves:

Purification StepMethodBuffer ConditionsNotes
Initial extractionDetergent solubilization1-2% mild detergent (DDM, LDAO, or Triton X-100) in PBS, pH 7.4Critical to select detergents that maintain native protein folding
Affinity chromatographyHis-tag or GST-tag based20 mM Tris-HCl pH 8.0, 300 mM NaCl, 0.1% detergentReduces bulk contaminants
Ion exchangeDEAE or CM Sepharose20 mM phosphate buffer pH 7.0, 0-500 mM NaCl gradientSeparates based on charge properties
Size exclusionSuperdex 75/20020 mM Tris-HCl pH 7.5, 150 mM NaCl, 0.05% detergentRemoves aggregates and provides analytical information

Each batch of purified protein should be assessed for homogeneity using SDS-PAGE and native PAGE. Detergent exchange during purification may be necessary depending on downstream applications .

What approaches are used to detect MT-CYB localization in cellular studies?

Detecting MT-CYB localization, particularly its nuclear presence, requires sensitive techniques:

  • Single-molecule fluorescence in situ hybridization (smFISH): This method has successfully detected MT-CYB RNA in both mitochondrial and nuclear locations. RNAscope technology using double Z probes has proven effective, with careful design to ensure probes do not match any nuclear genome sequences that could lead to false positive signals from nuclear mitochondrial DNA segments (NUMTs) .

  • Confocal microscopy with super-resolution imaging: These techniques have been essential for visualizing MT-CYB signals embedded in DAPI-stained nuclei. Three-dimensional reconstruction of confocal images can confirm nuclear localization .

  • Sequential smFISH: This approach provides independent validation of nuclear localization using separate pools of probes .

  • Co-localization studies: Combining smFISH for MT-CYB with immunofluorescence for nuclear markers (like SC35, which marks nuclear speckles and actively transcribed regions) helps confirm nuclear localization and potential transcriptional roles .

Control experiments using Rho0 cells (lacking mitochondrial DNA) are crucial to confirm the specificity of detection methods .

How can researchers quantify the functional activity of recombinant MT-CYB?

Quantification of MT-CYB functional activity requires multiple complementary approaches:

  • Spectrophotometric assays: Monitor the reduction and oxidation of cytochrome b using specific wavelengths (usually 550-560 nm) to assess electron transfer capability.

  • Oxygen consumption measurements: Using oxygen electrodes or fluorescence-based oxygen sensing to measure electron transport chain functionality when recombinant MT-CYB is incorporated into liposomes or submitochondrial particles.

  • Complex III activity assays: Measuring ubiquinol-cytochrome c reductase activity when recombinant MT-CYB is reconstituted with other complex III components.

  • Membrane potential assessments: Using fluorescent probes like JC-1 or TMRM to evaluate membrane potential generation in reconstituted systems.

  • Binding assays: Quantifying interactions with other respiratory chain components or inhibitors using surface plasmon resonance or isothermal titration calorimetry.

How can recombinant MT-CYB be used to study mitochondrial-nuclear communication?

Recent research has revealed that mitochondrial RNAs, including MT-CYB, can localize to the nucleus and potentially regulate nuclear transcription. Recombinant MT-CYB can be instrumental in elucidating these mechanisms through:

  • ChIP-seq approaches: Using tagged recombinant MT-CYB to identify potential chromatin binding sites and associated proteins.

  • RNA-protein interaction studies: Identifying nuclear proteins that interact with MT-CYB RNA using techniques like RNA immunoprecipitation followed by mass spectrometry (RIP-MS).

  • Transcription modulation experiments: Examining how introduction of recombinant MT-CYB affects expression of nuclear genes, particularly under stress conditions.

  • Structural studies: Investigating how MT-CYB RNA might form specific structures that facilitate nuclear localization or chromatin interaction.

Research has shown that MT-CYB can be detected in nuclear speckles (visualized with SC35 antibody) and in proximity to actively transcribed genes like VCAM1 and LINC00607, suggesting a role in transcriptional regulation . These findings indicate MT-CYB is part of a broader category of mitochondrial-chromatin attachment RNAs (mt-caRNAs) involved in retrograde signaling.

What insights can comparison between Lachesis muta muta MT-CYB and human MT-CYB provide?

Comparative studies between snake and human MT-CYB offer valuable insights:

  • Evolutionary conservation analysis: Regions highly conserved between species likely represent functionally critical domains, while variable regions may relate to species-specific adaptations.

  • Structural comparisons: Differences in folding, stability, or cofactor binding can inform structure-function relationships.

  • Disease-relevant mutations: Human MT-CYB mutations associated with pathologies (like the m.14864 T>C mutation causing a cysteine to arginine change at position 40) can be modeled in the snake protein to study functional consequences .

  • Nuclear localization signals: Comparing sequence elements that might facilitate nuclear transport between species can identify conserved mechanisms of mitochondrial-nuclear communication.

  • Protein-protein interaction networks: Differences in interaction partners may reveal species-specific regulatory mechanisms.

This comparative approach provides evolutionary context for understanding MT-CYB function across species and potentially identifies conserved regulatory mechanisms.

What are the current methodological challenges in studying MT-CYB's role in nuclear transcription?

Several technical challenges remain in fully characterizing MT-CYB's nuclear roles:

  • Distinguishing nuclear MT-CYB from NUMTs: Ensuring signals detected in the nucleus represent authentic mitochondrial transcripts rather than nuclear DNA sequences of mitochondrial origin (NUMTs) requires careful probe design and multiple validation approaches.

  • Temporal dynamics: Capturing the potentially transient nature of MT-CYB nuclear localization, particularly under different cellular stresses, requires time-resolved imaging techniques.

  • Functional validation: Establishing causal relationships between nuclear MT-CYB and transcriptional changes remains challenging. CRISPR-based approaches targeting specifically the mitochondrial genome (mitoTALENs or mitoCRISPR) are being developed to address this.

  • Isolation of nuclear MT-CYB complexes: Developing protocols to specifically isolate and characterize MT-CYB-containing ribonucleoprotein complexes from nuclear fractions without mitochondrial contamination.

  • Distinguishing direct vs. indirect effects: Determining whether MT-CYB directly regulates transcription or functions through intermediate factors requires sophisticated experimental designs combining RNA-protein crosslinking, chromatin capture, and transcriptional analyses.

Current research suggests that heat treatment significantly increases nuclear localization of MT-CYB in endothelial cells, and diabetes may also enhance this phenomenon, highlighting the physiological relevance of these mechanisms .

How should researchers design experiments to study MT-CYB mutations found in pathological conditions?

When investigating MT-CYB mutations associated with pathologies like MELAS syndrome, careful experimental design is essential:

  • Heteroplasmy modeling: Since mitochondrial mutations often exist in heteroplasmic states (mixture of wild-type and mutant mtDNA), expression systems should be designed to model varying ratios of mutant to wild-type MT-CYB.

  • Cell-type specific effects: Given that the m.14864 T>C mutation in MT-CYB presents with tissue-specific symptoms (migraines, epilepsy, sensorimotor neuropathy), experiments should include relevant cell types like neurons, muscle cells, and endothelial cells .

  • Functional readouts: Multiple functional parameters should be assessed, including:

    • Electron transport chain activity

    • ROS production

    • ATP synthesis

    • Calcium homeostasis

    • Nuclear localization patterns

    • Effects on nuclear gene expression

  • In vivo validation: Where possible, findings should be validated in appropriate animal models or patient-derived samples.

The observed heteroplasmy of the m.14864 T>C mutation in muscle, blood, fibroblasts, and urinary sediment from patients but absence in maternal tissues suggests important inheritance patterns that should be considered in experimental models .

What controls are necessary when studying nuclear localization of MT-CYB?

Robust controls are essential for reliable nuclear localization studies:

  • Rho0 cells: Cells depleted of mitochondrial DNA serve as critical negative controls to confirm probe specificity .

  • Subcellular fractionation validation: Biochemical fractionation should be validated using established markers for mitochondrial (e.g., TOMM20, COX4) and nuclear (e.g., Lamin B1, Histone H3) compartments.

  • RNase treatment controls: To distinguish RNA signals from potential DNA signals.

  • Probe specificity controls: Including scrambled sequence probes and probes targeting abundant non-mitochondrial RNAs.

  • Mitochondrial import inhibition: Experiments manipulating mitochondrial import machinery can help establish the source of nuclear MT-CYB.

  • Cross-validation with multiple techniques: Combining FISH, immunofluorescence, and biochemical approaches provides stronger evidence than any single method.

These controls help address the technical challenge of distinguishing authentic nuclear MT-CYB from potential artifacts or contamination .

How can contradictory findings regarding MT-CYB function be reconciled in experimental designs?

Contradictory findings in MT-CYB research can be addressed through:

  • Standardized experimental conditions: Variations in cell types, culture conditions, and stress stimuli can significantly impact MT-CYB behavior. Standardizing these parameters across studies helps reconcile divergent findings.

  • Multi-omics approaches: Integrating transcriptomics, proteomics, and metabolomics data provides a more comprehensive view of MT-CYB's functional impact.

  • Single-cell analysis: Population-level measurements can mask cell-to-cell variability in MT-CYB function or localization. Single-cell approaches like smFISH combined with single-cell RNA-seq help resolve apparent contradictions.

  • Temporal dynamics consideration: MT-CYB nuclear localization appears to increase under specific conditions like heat treatment, suggesting that timing of analysis is crucial .

  • Physiological relevance verification: In vitro findings should be validated in physiologically relevant contexts. For example, increased nuclear MT-CYB in endothelial cells from diabetic donors compared to non-diabetic controls supports the relevance of this phenomenon to human disease .

By implementing these approaches, researchers can better understand context-dependent aspects of MT-CYB function and resolve apparent contradictions in the literature.

What are promising therapeutic applications of recombinant MT-CYB research?

Several therapeutic avenues are emerging from MT-CYB research:

  • Mitochondrial disease therapeutics: Understanding how specific mutations in MT-CYB affect function can guide development of targeted therapies for conditions like MELAS syndrome .

  • Metabolic disease interventions: The role of MT-CYB in nuclear gene regulation suggests potential targets for metabolic disorders. Evidence from diabetic donors showing increased nuclear MT-CYB indicates relevance to diabetes pathophysiology .

  • Venom-derived therapeutics: Knowledge of Lachesis muta venom components, including potential cytochrome-related elements, guides development of novel therapeutics beyond antivenoms. The venom contains serine proteinases with potential applications in thrombotic disorders .

  • Biomarker development: MT-CYB nuclear localization patterns could serve as biomarkers for mitochondrial stress in various diseases.

  • Gene therapy approaches: Techniques developed to study MT-CYB could be adapted for targeted modification of mitochondrial genes to correct pathogenic mutations.

These applications represent the translational potential of fundamental research on recombinant MT-CYB.

How might integrative multi-omics approaches advance our understanding of MT-CYB function?

Integrative approaches combining multiple omics technologies offer powerful frameworks for comprehensively understanding MT-CYB:

  • Spatial transcriptomics with mtRNA detection: Emerging spatial transcriptomics methods could map MT-CYB RNA localization across tissues with unprecedented resolution.

  • Proteogenomics: Integrating genomic, transcriptomic, and proteomic data can reveal how variations in MT-CYB sequence affect protein function and interaction networks.

  • Metabolic flux analysis: Combining metabolomics with MT-CYB functional studies can elucidate how alterations in this protein affect cellular metabolism.

  • Single-cell multi-omics: Technologies allowing simultaneous profiling of transcriptome, proteome, and metabolome in single cells could reveal cell-to-cell variation in MT-CYB function.

  • 4D nucleome mapping: Technologies tracking chromatin dynamics could reveal how nuclear MT-CYB influences genome organization over time.

These integrative approaches promise to provide systems-level understanding of MT-CYB's diverse functions in both mitochondrial and nuclear contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.