Recombinant Lactobacillus acidophilus ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its incorporation.
Synonyms
atpF; LBA0774; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-169
Protein Length
full length protein
Species
Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Target Names
atpF
Target Protein Sequence
MTIQTLFAASHHIYLGNAIWYLLCFAILMLLIKHYAWGPVSDMMEKRRQKIISDLDSAAS DRKKAETLANEREAALKNSRQEATQILSDAKTNAQNTSKEIVASANEDAAAIRKKANEEA AKAKSDALDAARDQVADISVAIAEKVIAKNLSAEDQKDLVDQFIKGLDD
Uniprot No.

Target Background

Function
F(1)F(0) ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F(1) catalytic core (extramembraneous) and the F(0) membrane proton channel. These are connected by a central and peripheral stalk. ATP synthesis in the F(1) catalytic domain is coupled to proton translocation via the central stalk's rotary mechanism. This protein is a component of the F(0) channel and forms part of the peripheral stalk, linking F(1) to F(0).
Database Links

KEGG: lac:LBA0774

STRING: 272621.LBA0774

Protein Families
ATPase B chain family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the structure and function of ATP synthase in L. acidophilus?

ATP synthase in L. acidophilus is a multisubunit F1F0-ATPase complex that plays a crucial role in energy metabolism and acid tolerance. The F1F0-ATPase system of L. acidophilus has been well characterized, with the atp operon containing eight genes . This enzyme complex facilitates the extrusion of protons from the cytoplasm using proton motive force, which is essential for maintaining pH homeostasis in acidic environments . The inferred amino acid sequences of ATP synthase subunits in L. acidophilus show significant similarity to those found in Enterococcus hirae and Streptococcus mutans .

The ATP synthase complex consists of two main components:

  • F1: The catalytic portion that synthesizes ATP

  • F0: The membrane-embedded portion that acts as a proton channel

Subunit b (atpF) is a critical component of the F0 portion, serving as part of the peripheral stalk that connects F1 and F0 domains and helps maintain the structural integrity of the complex during rotational catalysis.

How does ATP synthase contribute to acid tolerance in L. acidophilus?

ATP synthase plays a vital role in the acid tolerance mechanisms of L. acidophilus through proton pumping activity. When L. acidophilus is exposed to low pH environments, there is an increase in the abundance of ATPase-specific mRNA, indicating regulation at the transcriptional level . This upregulation enhances the cell's ability to maintain cytoplasmic pH by extruding protons from the cell interior.

In acidic conditions, the F1F0-ATPase operates primarily in the direction of ATP hydrolysis to pump protons out of the cell, consuming ATP to maintain the intracellular pH at levels compatible with cellular functions. This mechanism, along with amino acid decarboxylation-antiporter systems, constitutes the main proton pumps utilized by L. acidophilus to survive in acidic environments such as the gastrointestinal tract .

What are the key considerations for designing experiments to study atpF function?

When designing experiments to study atpF function in L. acidophilus, researchers should follow systematic experimental design principles:

  • Define variables clearly: Identify independent variables (e.g., atpF expression levels, pH conditions) and dependent variables (e.g., ATP production, acid tolerance) .

  • Formulate specific hypotheses: Create testable hypotheses about atpF function based on current understanding of ATP synthase .

  • Control for extraneous variables: Consider factors that might influence results, such as growth phase, media composition, and temperature .

  • Select appropriate experimental groups: Design control groups (wild-type strains) and experimental groups (atpF-modified strains) .

  • Measurement methodology: Determine how to quantify ATP production, proton pumping activity, or acid tolerance.

A robust experimental design might include:

Experimental GroupTreatmentVariables MeasuredControls
Wild-type L. acidophilusVarying pH conditionsATP levels, growth rate, protein expressionMedia only, heat-killed cells
atpF-overexpressing strainVarying pH conditionsATP levels, growth rate, protein expressionWild-type with empty vector
atpF-knockout/knockdownVarying pH conditionsATP levels, growth rate, protein expressionWild-type with control construct

How can insertional inactivation be used to study atpF function?

Insertional inactivation is a valuable technique for studying gene function by disrupting the target gene. Based on methodologies used for similar studies in L. acidophilus, the following approach could be applied to atpF:

  • Target identification: Precisely locate the atpF gene within the atp operon of L. acidophilus.

  • Construction of integration vector: Create a vector containing a region homologous to atpF with an antibiotic resistance marker .

  • Transformation: Introduce the integration vector into L. acidophilus using electroporation or other appropriate transformation methods.

  • Selection: Use appropriate antibiotics to select for transformants where homologous recombination has occurred.

  • Verification: Confirm successful integration using PCR, Southern blotting, or DNA sequencing.

  • Phenotypic analysis: Compare the acid tolerance of the atpF-inactivated strain with the parental strain under various acidic conditions .

Previous research on acid tolerance genes in L. acidophilus demonstrated that integrants were more sensitive to low pH than the parental strain, highlighting the importance of these genes in acid response mechanisms .

What expression systems are optimal for recombinant atpF production in L. acidophilus?

For successful recombinant expression of atpF in L. acidophilus, researchers can consider several expression systems:

  • Constitutive expression systems: Using strong constitutive promoters native to L. acidophilus ensures consistent expression but may impose metabolic burden.

  • Inducible expression systems: Systems responsive to environmental cues (pH, temperature) or specific inducers allow controlled expression.

  • Cell surface display systems: For studies requiring surface localization, fusion strategies similar to those used for Salmonella flagellin (FliC) can be employed .

Two particularly promising anchor motifs for recombinant protein expression in L. acidophilus include:

  • C-terminal region of cell envelope proteinase (PrtP): This approach binds the recombinant protein to the cell wall through electrostatic interactions .

  • Anchor region of mucus binding protein (Mub): This method uses an LPXTG motif to covalently associate the recombinant protein with the cell wall .

These different expression strategies result in distinct localization patterns and stability characteristics, which should be considered based on the research objectives.

How can the stability of recombinant atpF be improved in experimental settings?

Recombinant proteins expressed on the L. acidophilus cell surface, including potential atpF constructs, can be highly sensitive to proteolytic degradation, particularly under simulated gastric and intestinal conditions . To improve stability:

  • Buffer supplementation: Adding bicarbonate buffer can protect surface-associated proteins from proteolytic enzymes during gastric challenge in vitro .

  • Protease inhibitors: Supplementation with soybean trypsin inhibitor has been shown to protect cell surface antigens from degradation .

  • Fusion partners: Certain protein domains can enhance stability - careful selection of fusion partners may improve recombinant atpF stability.

  • Expression optimization: Adjusting expression levels to prevent misfolding or aggregation that might trigger proteolytic degradation.

  • Growth phase considerations: Expressing recombinant proteins during specific growth phases may affect stability and functionality.

Research has demonstrated that protective reagents not only preserve surface-associated proteins but also increase the viability of L. acidophilus cells when challenged with simulated digestive juices .

How does atpF expression correlate with acid tolerance mechanisms?

The expression of ATP synthase genes, including atpF, is directly linked to acid tolerance mechanisms in L. acidophilus. When exposed to low pH environments, L. acidophilus exhibits an adaptive acid response characterized by:

  • Transcriptional upregulation: Increased abundance of ATPase-specific mRNA .

  • Enhanced proton extrusion: Greater activity of the F1F0-ATPase complex to maintain intracellular pH.

  • Coordinated response: Multiple mechanisms working together to respond to acid challenge .

The adaptive acid response observed during logarithmic growth in L. acidophilus mutants suggests that atpF, as part of the ATP synthase complex, contributes to a broader, orchestrated acid tolerance response involving multiple cellular mechanisms .

What methods are available for measuring ATP production in recombinant L. acidophilus strains?

Several methodologies can be employed to quantify ATP production in recombinant L. acidophilus strains:

  • Luminescence-based ATP assays: Using luciferin-luciferase reactions to measure intracellular ATP content.

  • High-performance liquid chromatography (HPLC): For quantitative determination of adenine nucleotides.

  • Enzymatic coupled assays: Measuring ATP through linked enzyme reactions.

  • Oxygen consumption measurements: Using oxygen electrodes to assess respiratory activity linked to ATP synthesis.

  • pH-sensitive fluorescent probes: For monitoring changes in proton gradient during ATP synthesis.

A decrease in ATP content has been observed in cells under stress conditions, such as exposure to advanced glycation end-products (AGEs), suggesting that ATP measurement can serve as an indicator of cellular stress responses .

What omics approaches can advance our understanding of atpF function in L. acidophilus?

Integrated omics approaches offer powerful tools for comprehensive analysis of atpF function:

  • Transcriptomics: RNA-seq analysis can reveal how atpF expression changes under different conditions and how its expression correlates with other genes. Previous transcriptional analysis has successfully identified upregulated host interaction genes in L. acidophilus .

  • Proteomics: Mass spectrometry-based techniques can quantify atpF protein levels and identify post-translational modifications.

  • Metabolomics: Analyzing changes in metabolite profiles in atpF mutants can reveal downstream effects on cellular metabolism.

  • Comparative genomics: Examining atpF sequence conservation across Lactobacillus species can provide evolutionary insights.

  • Systems biology: Integrating multiple omics datasets to model how atpF functions within the broader cellular network.

Omics ApproachTechniqueInformation GainedRelevance to atpF Research
TranscriptomicsRNA-seqGene expression patternsRegulatory networks involving atpF
ProteomicsLC-MS/MSProtein levels, modificationsPost-translational regulation of atpF
MetabolomicsGC-MS, LC-MSMetabolite profilesImpact of atpF on cellular energetics
GenomicsWhole genome sequencingGenetic context, variationEvolutionary conservation of atpF
InteractomicsCo-IP, Y2HProtein-protein interactionsatpF interaction partners

What are the most common issues in recombinant atpF expression and how can they be addressed?

Researchers working with recombinant atpF in L. acidophilus may encounter several challenges:

  • Low expression levels: Optimize codon usage, promoter strength, and ribosome binding sites specific to L. acidophilus.

  • Protein misfolding: Adjust expression temperature, introduce molecular chaperones, or use fusion tags that enhance solubility.

  • Toxicity to host cells: Use tightly regulated inducible systems and optimize induction conditions.

  • Instability of constructs: Select appropriate antibiotic selection markers and optimize plasmid copy number.

  • Difficulty in verification: Develop specific antibodies or use epitope tags for detection of recombinant atpF.

When working with surface display systems, it's important to consider that different anchor motifs can result in dissimilar properties. For example, research has shown that different recombinant L. acidophilus surface displays resulted in varying levels of maturation and cytokine production by human myeloid dendritic cells .

How can contradictory data in atpF studies be reconciled?

When facing contradictory results in atpF research:

  • Methodological differences: Carefully examine experimental conditions, strain backgrounds, and methodologies used.

  • Growth phase effects: ATP synthase expression and activity can vary significantly depending on growth phase.

  • Environmental conditions: pH, temperature, and media composition can substantially influence results.

  • Genetic background variations: Different L. acidophilus strains may exhibit variations in atpF sequence or regulation.

  • Assay sensitivity: Different measurement techniques may have varying sensitivities or limitations.

The complexity of cellular responses to stress should be considered when interpreting results. For instance, L. acidophilus exhibits multiple mechanisms in response to acid challenge, which are orchestrated together . This complexity could explain apparently contradictory results in different experimental settings.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.