Recombinant Lactobacillus acidophilus Glycerol-3-phosphate acyltransferase 2 (plsY2)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

PlsY2 is a membrane-associated enzyme in L. acidophilus responsible for catalyzing the first committed step of glycerolipid biosynthesis. It transfers a fatty acyl group from acyl-phosphate to the sn-1 position of glycerol-3-phosphate (G3P), forming lysophosphatidic acid (LPA). This reaction is essential for synthesizing phospholipids, which are fundamental to bacterial membrane structure and function .

Enzymatic Mechanism

PlsY2 operates as a glycerol-3-phosphate acyltransferase (GPAT), utilizing acyl-phosphate as a substrate instead of acyl-CoA, which is typical for eukaryotic GPATs . The reaction proceeds as:

G3P + acyl-phosphateLPA + phosphate\text{G3P + acyl-phosphate} \rightarrow \text{LPA + phosphate}

This mechanism is distinct from E. coli PlsB (acyl-CoA-dependent) but shares functional parallels with other bacterial GPATs like PlsY, which also use acyl-phosphate .

Applications in Research

Recombinant PlsY2 is utilized for:

  • Lipidomics Studies: Tracing phospholipid biosynthesis pathways in L. acidophilus.

  • Enzyme Engineering: Optimizing acyltransferase activity for synthetic biology applications.

  • Membrane Biology: Investigating how lipid composition affects probiotic strain survival under gastrointestinal stress .

Comparative Analysis with Other GPATs

FeatureL. acidophilus PlsY2E. coli PlsYPlant GPAT9
SubstrateAcyl-phosphateAcyl-phosphateAcyl-CoA
LocalizationMembrane-associatedMembrane-associatedEndoplasmic reticulum
Role in MotilityNot characterizedIndirectly regulates flagellaN/A
Catalytic MotifsPresumed His176/Asp181His144/Asp149His171/Asp176

Research Gaps and Future Directions

  • Structural Data: No crystal structure of PlsY2 is available; homology modeling could clarify substrate-binding pockets.

  • Physiological Impact: The role of PlsY2 in L. acidophilus stress adaptation (e.g., acid tolerance) remains unexplored.

  • Biotechnological Potential: Engineering PlsY2 for tailored lipid production in industrial strains.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery time estimates.
Note: All protein shipments default to blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol final concentration is 50%. Customers can use this as a reference point.
Shelf Life
Shelf life is influenced by factors such as storage state, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
plsY2; LBA1121; Glycerol-3-phosphate acyltransferase 2; Acyl-PO4 G3P acyltransferase 2; Acyl-phosphate--glycerol-3-phosphate acyltransferase 2; G3P acyltransferase 2; GPAT 2; Lysophosphatidic acid synthase 2; LPA synthase 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-211
Protein Length
full length protein
Species
Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Target Names
plsY2
Target Protein Sequence
MFALKFASLFILAYLLGSFPAGVVVGKIFFYKDIRKYGSGNIGTTNTFRVLGPVAGIIVF LIDFFKGTLATLIPVIFNLGPHYLCLIFGLVAILGHAFPIFLKFKGGKAVATSAGFLLGY NVHFFLICAVIFIPILFITSMVSLTSLISVVLIFIASFFFHDIALSIISGLLVILIYWSH RSNIARIEKHQENMVPFGVVYWLKNKHTKSK
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P) to form lysophosphatidic acid (LPA). It utilizes acyl-phosphate as the fatty acyl donor, but not acyl-CoA or acyl-ACP.
Database Links

KEGG: lac:LBA1121

STRING: 272621.LBA1121

Protein Families
PlsY family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the biochemical function of Glycerol-3-phosphate acyltransferase 2 (plsY2) in Lactobacillus acidophilus?

Glycerol-3-phosphate acyltransferase 2 (plsY2) in L. acidophilus catalyzes the first and rate-limiting step in the de novo pathway of glycerolipid synthesis. This enzyme specifically transfers an acyl group from acyl-CoA to glycerol-3-phosphate, producing lysophosphatidic acid (LPA), which serves as a precursor for the synthesis of phospholipids and triglycerides. In L. acidophilus, this pathway is essential for membrane phospholipid biosynthesis, influencing bacterial cell envelope composition and properties . As a membrane-associated enzyme, plsY2 plays a crucial role in maintaining proper membrane integrity and permeability, which directly impacts the bacterium's survival in various environmental conditions.

How does plsY2 differ between bacterial species and from mammalian GPAT isoforms?

When comparing L. acidophilus plsY2 with its counterpart in L. johnsonii, significant sequence similarities exist, though the L. johnsonii enzyme is slightly larger at 218 amino acids . The table below highlights key differences between bacterial plsY2 and mammalian GPAT isoforms:

FeatureBacterial plsY2Mammalian GPATs
IsoformsTypically 1-2 isoformsFour distinct isoforms (GPAT1-4)
Subcellular localizationPlasma membrane-associatedGPAT1/2: Mitochondrial outer membrane
GPAT3/4: Endoplasmic reticulum membrane
Size~210-220 amino acidsSignificantly larger (>800 amino acids)
FunctionPrimarily membrane phospholipid synthesisTissue-specific roles in triglyceride synthesis and metabolism
Physiological roleCell membrane biosynthesisImplicated in obesity, hepatic steatosis, and insulin resistance
Substrate specificityGenerally narrowerBroader with isoform-specific preferences
NEM sensitivityVariableUsed as a distinguishing characteristic between isoforms

These differences reflect the evolutionary divergence and specialized functions of these enzymes across domains of life .

What are the optimal conditions for expressing functional recombinant L. acidophilus plsY2?

The optimal expression of functional recombinant L. acidophilus plsY2 requires careful consideration of multiple experimental parameters:

  • Expression system: E. coli is the preferred host for recombinant plsY2 expression, particularly BL21(DE3) or Rosetta strains that compensate for rare codons present in Lactobacillus genes .

  • Vector design: pET-based expression vectors with T7 promoters are commonly utilized, with the plsY2 gene fused to an N-terminal His-tag for purification purposes.

  • Growth and induction protocol:

    • Culture in LB or 2xYT media at 37°C until OD600 reaches 0.6-0.8

    • IPTG induction at 0.1-0.5 mM

    • Reduce temperature to 16-25°C post-induction to enhance proper folding

    • Continue expression for 4-16 hours depending on temperature

  • Cell lysis and protein extraction:

    • Gentle lysis methods using lysozyme combined with mild detergents

    • Buffer conditions: Tris/PBS-based buffers at pH 8.0

    • Addition of protease inhibitors to prevent degradation

  • Purification strategy:

    • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

    • Inclusion of stabilizers such as 6% trehalose in storage buffer

    • Elution using imidazole gradient or pH change

  • Storage conditions:

    • Aliquoting to prevent repeated freeze-thaw cycles

    • Addition of 5-50% glycerol as cryoprotectant

    • Storage at -20°C to -80°C for long-term stability

These parameters must be empirically optimized for specific constructs, as variations in sequence or tags can significantly affect expression levels and protein solubility.

What challenges arise in maintaining enzymatic activity of recombinant plsY2 and how can they be addressed?

Several methodological challenges must be addressed when expressing recombinant plsY2 to maintain its enzymatic activity:

  • Membrane integration issues:

    • Challenge: As a membrane-associated enzyme, plsY2 requires proper integration into lipid bilayers for activity

    • Solution: Express in membrane fractions or include lipid/detergent mixtures during purification

  • Protein folding and solubility:

    • Challenge: Hydrophobic regions can cause aggregation and inclusion body formation

    • Solution: Lower expression temperature (16-20°C), use fusion partners that enhance solubility, or develop refolding protocols with lipid reconstitution

  • Substrate availability:

    • Challenge: Heterologous hosts may have different acyl-CoA substrate pools

    • Solution: Supplement growth media with preferred fatty acids or co-express acyl-CoA synthetases specific for preferred substrates

  • Buffer optimization for activity assays:

    • Challenge: Enzyme activity is highly dependent on buffer composition

    • Solution: Screen various buffer systems, pH ranges, and ionic strengths to identify optimal conditions for activity measurement

  • Stability during storage:

    • Challenge: Activity loss during freeze-thaw cycles

    • Solution: Add stabilizers (trehalose, glycerol), maintain at pH 8.0, avoid repeated freezing and thawing

  • Activity verification methodology:

    • Challenge: Confirming that recombinant enzyme retains native catalytic properties

    • Solution: Develop reliable activity assays that can detect product formation, such as coupled enzyme systems or direct detection of lysophosphatidic acid production

Addressing these challenges through systematic optimization is essential for obtaining functionally active recombinant plsY2 for research applications.

How does plsY2 expression affect membrane properties and cellular physiology in L. acidophilus?

The expression of plsY2 significantly impacts membrane properties and cellular physiology in L. acidophilus through its role in phospholipid biosynthesis. Research methodologies to investigate these effects include:

  • Membrane composition analysis:

    • Lipid extraction using chloroform-methanol methods

    • Gas-liquid chromatography analysis for fatty acid composition

    • Mass spectrometry for detailed phospholipid profiling

  • Membrane physical properties assessment:

    • Atomic force microscopy (AFM) to analyze cell surface topography and roughness

    • Fluorescence anisotropy measurements for membrane fluidity evaluation

    • Permeability assays using fluorescent dyes or other molecular probes

Results from such studies indicate that alterations in plsY2 expression can lead to:

  • Changes in arachidonic acid content in glycerolipids

  • Compensatory upregulation of other lipid biosynthesis enzymes (e.g., AGPAT11)

  • Modifications in membrane roughness and permeability

  • Altered resistance to environmental stresses

A comprehensive investigation by Cattaneo et al. demonstrated that GPAT2 expression impacts cell roughness and membrane permeability, which can be measured quantitatively using atomic force microscopy. Similar methodologies can be applied to study recombinant L. acidophilus plsY2.

What enzyme kinetics approaches are most effective for characterizing recombinant plsY2 activity?

Effective characterization of recombinant plsY2 enzymatic activity requires multiple complementary analytical approaches:

  • Spectrophotometric assays:

    • Continuous monitoring of glycerol-3-phosphate acyltransferase activity using coupled enzyme systems

    • Measurement of CoA release through thiol-reactive reagents (e.g., DTNB/Ellman's reagent)

    • Advantages: Real-time monitoring, high-throughput capability

    • Limitations: Potential interference from other components in the reaction mixture

  • Radiometric assays:

    • Use of radiolabeled substrates ([14C]glycerol-3-phosphate or [14C]acyl-CoA)

    • Separation of products by thin-layer chromatography

    • Quantification via scintillation counting

    • Advantages: High sensitivity, direct measurement of product formation

    • Limitations: Handling radioactive materials, specialized equipment requirements

  • Mass spectrometry-based methods:

    • LC-MS/MS for direct detection and quantification of lysophosphatidic acid products

    • Advantages: High specificity, ability to identify multiple reaction products

    • Limitations: Complex sample preparation, expensive instrumentation

  • Enzyme kinetics determination:

    • Measurement of initial rates at varying substrate concentrations

    • Determination of kinetic parameters (Km, Vmax, kcat)

    • Construction of Lineweaver-Burk or Eadie-Hofstee plots

    • Substrate specificity analysis using various acyl-CoA donors

  • Inhibition studies:

    • Testing with known GPAT inhibitors (e.g., FSG67)

    • Determination of inhibition constants (Ki)

    • Identification of inhibition mechanisms (competitive, noncompetitive, uncompetitive)

A multi-method approach provides complementary data on enzyme activity, substrate preferences, and kinetic parameters, which are essential for understanding the biochemical function of recombinant plsY2.

How can computational methods predict stability improvements in recombinant plsY2?

Molecular dynamics (MD) simulations and computational protein design offer powerful approaches for predicting stability improvements in recombinant plsY2, as demonstrated for other L. acidophilus enzymes :

  • Structure preparation methodology:

    • Homology modeling of L. acidophilus plsY2 using related protein structures as templates

    • Energy minimization and model validation using standard tools

    • Preparation for simulation in explicit solvent environments

  • Identification of flexible regions:

    • MD simulations at both optimal and elevated temperatures (typically 100-200 ns)

    • Calculation of root mean square fluctuation (RMSF) values across the protein structure

    • Identification of highly flexible regions as primary targets for stabilization

  • Computational design strategy:

    • Application of protein design algorithms (e.g., Rosetta) to identify stabilizing mutations

    • Calculation of ΔΔG values to predict energetic improvements

    • Selection of mutations with ΔΔG < 0 Rosetta Energy Units (REU)

  • Simulation-based validation:

    • MD simulations of designed mutants at high temperatures

    • Comparison of RMSF values between wild-type and mutant proteins

    • Selection of promising candidates showing significant ΔRMSF reductions (lower than -10.0%)

  • Analysis of stabilization mechanisms:

    • Examination of hydrogen bond networks in mutant structures

    • Evaluation of salt bridge formation and hydrophobic interactions

    • Assessment of solvent accessibility changes

This computational approach, similar to that used for L. acidophilus α-L-rhamnosidase , provides a rational strategy for enhancing the stability of recombinant plsY2 through targeted mutations, which can then be validated experimentally.

How can surface display techniques be optimized for expressing plsY2 on L. acidophilus cell surfaces?

Surface display of plsY2 on L. acidophilus cells requires careful selection of anchoring motifs and expression strategies. Based on documented approaches for other recombinant proteins in L. acidophilus , the following methodology can be applied:

  • Anchor selection and design:

    • Two primary anchoring strategies have proven effective:
      a) Non-covalent anchoring using C-terminal regions of cell envelope proteinases (PrtP)
      b) Covalent anchoring using LPXTG motifs from mucus binding proteins (Mub)

  • Fusion protein construction protocol:

    • Design gene fusions linking plsY2 to the selected anchor domain

    • For PrtP-anchoring: Fuse plsY2 to the C-terminal region of PrtP containing cell wall binding domains

    • For Mub-anchoring: Fuse plsY2 to the anchor region containing the LPXTG motif

    • Include appropriate spacers to ensure proper folding and accessibility

  • Expression vector optimization:

    • Select appropriate promoters for expression in L. acidophilus (e.g., SlpA promoter)

    • Include efficient signal peptides for secretion

    • Incorporate selection markers for stable maintenance

  • Surface display verification techniques:

    • Flow cytometry using specific antibodies against plsY2 or attached tags

    • Western blotting of cell wall extracts

    • Immunofluorescence microscopy

    • Enzymatic activity assays on whole cells

  • Stability assessment under physiological conditions:

    • Exposure to simulated gastric and intestinal juices

    • Protection strategies: bicarbonate buffer and soybean trypsin inhibitor supplementation

    • Quantitative measurement of retained surface proteins after various treatments

The choice between covalent and non-covalent anchoring significantly impacts display efficiency and stability, with covalently bound proteins (LPXTG-anchored) generally showing greater resistance to environmental challenges .

What are the immunological implications of using recombinant L. acidophilus plsY2 in research applications?

Recombinant L. acidophilus strains expressing surface proteins have demonstrated significant immunomodulatory properties, which can be leveraged in various research applications. The methodology for assessing immunological effects includes:

  • Dendritic cell response analysis:

    • Co-culture of human myeloid dendritic cells (DCs) with recombinant L. acidophilus

    • Flow cytometric assessment of DC maturation markers (CD40, CD80, CD83, CD86)

    • Analysis of pattern recognition receptor expression (e.g., TLR5)

  • Cytokine production profiling:

    • Measurement of pro- and anti-inflammatory cytokines in culture supernatants

    • ELISA or multiplex bead-based assays for cytokine quantification

    • Real-time PCR for cytokine gene expression analysis

  • NF-κB activation assessment:

    • Reporter gene assays using TLR-expressing HEK293 cells

    • Luciferase-based detection of NF-κB activation

    • Comparison between different recombinant constructs

Studies with surface-displayed proteins on L. acidophilus have shown that:

  • Different anchoring motifs can lead to distinct immunological outcomes

  • Covalently bound (LPXTG-anchored) and non-covalently bound (PrtP-anchored) antigens induce different patterns of dendritic cell maturation

  • Recombinant L. acidophilus strains can differentially regulate TLR5 expression on human dendritic cells

  • The concentration of L. acidophilus cells significantly impacts immune responses

These findings provide a methodological framework for understanding how recombinant L. acidophilus plsY2 might influence immune responses in various research applications.

How can site-directed mutagenesis enhance the catalytic efficiency of recombinant plsY2?

A systematic approach to enhancing the catalytic efficiency of recombinant plsY2 through site-directed mutagenesis includes:

  • Target residue identification methodology:

    • Sequence alignment with related enzymes of known function

    • Structural analysis through homology modeling

    • Molecular docking of substrates to predict key interaction residues

    • Evolutionary analysis to identify conserved vs. variable positions

  • Rational design strategy:

    • Modification of catalytic site residues to optimize chemical reactivity

    • Enhancement of substrate binding through changes in binding pocket residues

    • Alteration of active site electrostatics to improve catalysis

    • Targeting flexible regions that might limit reaction rates

  • Site-directed mutagenesis protocol:

    • PCR-based mutagenesis techniques (e.g., QuikChange or overlap extension PCR)

    • Primer design considerations: optimal Tm, minimal secondary structure

    • Transformation and screening procedures

    • Sequencing verification of mutations

  • Functional characterization of mutants:

    • Enzymatic activity assays comparing wild-type and mutant enzymes

    • Determination of kinetic parameters (Km, kcat, kcat/Km)

    • Substrate specificity profiling using various acyl-CoA donors

    • pH-activity and temperature-activity profiles

  • Structural validation approaches:

    • Circular dichroism spectroscopy to confirm maintained secondary structure

    • Thermal shift assays to assess stability changes

    • Molecular dynamics simulations to understand the structural basis of improved catalysis

Similar approaches have been successfully applied to other L. acidophilus enzymes, such as α-L-rhamnosidase, where computational design and site-directed mutagenesis led to enhanced stability through increased hydrogen bond interactions .

How does plsY2 interact with other components of the lipid biosynthesis pathway in L. acidophilus?

Understanding plsY2 interactions within the lipid biosynthesis pathway requires an integrated methodological approach:

  • Pathway reconstruction analysis:

    • Genomic identification of all genes involved in phospholipid and glycerolipid biosynthesis

    • Annotation of enzymes in the pathway

    • Metabolic flux analysis to determine rate-limiting steps

  • Protein-protein interaction studies:

    • Co-immunoprecipitation with tagged plsY2

    • Bacterial two-hybrid screening for interacting partners

    • Cross-linking studies followed by mass spectrometry analysis

  • Gene expression correlation:

    • qRT-PCR to analyze co-regulation of pathway genes

    • RNA-seq for global transcriptional analysis

    • Analysis of compensatory expression when plsY2 expression is altered

Research has shown that when GPAT2 is silenced, other glycerolipid biosynthetic enzymes like AGPAT11 may be upregulated to compensate . This suggests a complex regulatory network within the pathway where alterations in one enzyme's activity can trigger compensatory mechanisms involving other pathway components.

The experimental approach should include:

  • Targeted gene knockdown or overexpression of plsY2

  • Comprehensive lipidomic analysis to assess pathway flux

  • Measurement of enzyme activities throughout the pathway under various conditions

  • Computational modeling to predict pathway responses to perturbations

This integrated methodology provides insights into how plsY2 functions within the broader context of lipid metabolism in L. acidophilus, with implications for bacterial physiology and potential biotechnological applications.

What analytical techniques can detect structural changes in membrane composition due to altered plsY2 activity?

Detecting and quantifying membrane compositional changes resulting from altered plsY2 activity requires sophisticated analytical techniques:

  • Lipid extraction and fractionation methods:

    • Bligh-Dyer method or similar chloroform-methanol extraction techniques

    • Solid-phase extraction for lipid class separation

    • High-performance thin-layer chromatography (HPTLC) for lipid class analysis

  • Gas chromatography analysis:

    • Fatty acid methyl ester (FAME) preparation from extracted lipids

    • Gas-liquid chromatography with flame ionization detection

    • Identification of changes in fatty acid composition, particularly arachidonic acid content

  • Mass spectrometry-based lipidomics:

    • Electrospray ionization mass spectrometry (ESI-MS)

    • MALDI-TOF MS for rapid lipid profiling

    • LC-MS/MS for comprehensive phospholipid analysis

    • Quantification of phospholipid-to-glycolipid ratios

  • Membrane biophysical property assessment:

    • Atomic force microscopy to analyze cell surface topography and roughness

    • Differential scanning calorimetry to measure phase transition temperatures

    • Fluorescence anisotropy to determine membrane fluidity

    • Laurdan generalized polarization for membrane order measurements

Research by Cattaneo et al. demonstrated that GPAT2 expression modulates cell roughness and membrane permeability, which can be precisely measured using atomic force microscopy. Their study revealed that GPAT2 expressing cells exhibited rougher topography and less membrane damage than GPAT2 silenced cells, highlighting the significant impact of GPAT activity on membrane properties.

The analytical approach should integrate multiple techniques to provide a comprehensive assessment of how plsY2 activity influences membrane lipid composition and the resulting physical properties of the bacterial cell envelope.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.