Recombinant Lactobacillus acidophilus Prolipoprotein diacylglyceryl transferase (lgt)

What is Prolipoprotein Diacylglyceryl Transferase (Lgt) in Lactobacillus acidophilus?

Prolipoprotein diacylglyceryl transferase (Lgt) is an integral membrane enzyme that catalyzes the first critical step of a three-step post-translational lipid modification process in bacterial lipoprotein biogenesis. In L. acidophilus, Lgt is responsible for transferring diacylglyceryl from phosphatidylglycerol to the sulfhydryl group of the conserved cysteine residue in the "lipobox" motif of lipoprotein precursors. This modification is essential for anchoring lipoproteins to the extracellular face of the cytoplasmic membrane. The lipobox consists of a conserved [L/V/I]-[A/S/T]-[G/A]-C motif located at the C-terminus of the N-terminal signal sequence of prolipoproteins . In L. acidophilus, the lgt gene encodes a 280-amino acid protein with multiple transmembrane domains that facilitates this lipid modification process .

How is the structure of Lgt characterized in L. acidophilus?

The L. acidophilus Lgt protein (Uniprot ID: Q5FL71) consists of 280 amino acids with multiple transmembrane domains characteristic of integral membrane proteins. The complete amino acid sequence is:

MMTKLVINPVAFQLGSLSVKWYGIIMAVAIVLATWMAISEGKKRQIISDDFVDLLLWAVP
LGYVGARIYYVIFEWGYYSKHPNQIIAIWNGGIAIYGGLIAGLIVLLIFCHKRDLPPFLM
LDIITPGVMAAQILGRWGNFVNQEAHGGPTTLHFLQSLHLPEFVIQQMKIGGTYYQPTFL
YESFFNLIGLIIILSLRHRKHVFKQGEVFMSYLLWYSVVRFFVEGMRTDSLYIFGIIRVS
QALSLVLFIATIILWIYRRKVVKPKWYLQGSGLKYPYTRD

While a crystal structure of L. acidophilus Lgt has not been reported in the provided search results, structural insights can be inferred from the solved crystal structure of E. coli Lgt, which has been determined at high resolution (1.9 Å and 1.6 Å) in complex with phosphatidylglycerol and the inhibitor palmitic acid . The E. coli structure reveals two binding sites that are critical for diacylglyceryl transfer function, with conserved residues (such as Arg143 and Arg239) playing essential roles in catalysis . Comparative genomic analysis suggests structural conservation across bacterial Lgt enzymes despite some sequence variations.

What genomic context surrounds the lgt gene in L. acidophilus?

In L. acidophilus NCFM, genomic analysis has revealed various operons and genetic contexts for functional genes. While the specific genomic context of the lgt gene (LBA0677) is not explicitly detailed in the provided search results, studies of other important loci in L. acidophilus provide insights into how genes are organized. For instance, the msm locus in L. acidophilus NCFM is composed of a transcriptional regulator of the LacI family, a four-component ATP-binding cassette transport system, a fructosidase, and a sucrose phosphorylase . This demonstrates how functionally related genes in L. acidophilus are typically organized into operons. Similar organization might be expected for lgt and related lipoprotein processing genes, although the specific arrangement would need to be determined through targeted genomic analysis.

What is the role of Lgt in L. acidophilus physiology?

Lgt plays a crucial role in L. acidophilus physiology by enabling proper lipoprotein biosynthesis and anchoring to the cell membrane. Lipoproteins in bacteria fulfill wide-ranging and vital biological functions, including maintenance of cell envelope architecture, insertion and stabilization of outer membrane proteins, nutrient uptake, transport, adhesion, invasion, and virulence . In probiotic bacteria like L. acidophilus, lipoproteins also contribute significantly to immunomodulatory properties by interacting with host immune receptors, particularly Toll-like receptor 2 (TLR2) . While direct studies on lgt mutants in L. acidophilus are not presented in the search results, research on the related species L. plantarum WCFS1 has shown that lgt deletion affects the secreted proteome and specifically leads to the release of predicted lipoproteins that remain non-acylated . This suggests that lgt is critical for maintaining the proper localization and function of numerous proteins involved in bacterial physiology.

How does lgt deletion affect bacterial proteome and immunomodulatory properties?

Studies in Lactobacillus plantarum WCFS1, a model probiotic strain related to L. acidophilus, have shown that deletion of the lgt gene has significant effects on both the bacterial proteome and immunomodulatory properties. When lgt is deleted, predicted lipoproteins that would normally be acylated and anchored to the cell membrane are instead released into the extracellular environment in a non-acylated form . This alteration in protein localization affects multiple cellular functions.

Most significantly, the lgt mutant strain shows a reduced capacity to stimulate TLR2 signaling compared to the wild-type strain, demonstrating that lipoproteins with their acyl chains are critical drivers of TLR2-mediated immunomodulation . This specifically affects TLR1/2 signaling pathways, suggesting that L. plantarum lipoproteins are likely tri-acylated or contain N-acylation with long-chain fatty acid modifications that are recognized through TLR1/2 rather than TLR2/6 .

Interestingly, despite these significant changes in protein localization and immunomodulatory properties, the growth and cell morphology of the lgt deletion mutant were indistinguishable from those of the wild-type strain under laboratory conditions . This observation aligns with previous findings suggesting that while Lgt is essential in Gram-negative bacteria, it appears to be dispensable in Gram-positive bacteria grown under standard laboratory conditions .

What are the differences in Lgt function between Gram-positive and Gram-negative bacteria?

Significant differences exist in Lgt function and essentiality between Gram-positive and Gram-negative bacteria:

In Gram-negative bacteria like E. coli, deletion of the lgt gene is typically lethal, whereas Gram-positive bacteria like L. plantarum can survive without lgt under laboratory conditions . Historically, it was assumed that low-GC-content Gram-positive bacteria, including Lactobacillus species, produce di-acyl lipoproteins because no homolog of the Gram-negative lnt gene (responsible for transferring a third acyl chain) was recognized in their genomes .

How can recombinant L. acidophilus Lgt be used for heterologous antigen display?

Recombinant L. acidophilus strains can be engineered to display heterologous antigens on their cell surface, a technique considered useful for vaccine delivery. While the provided search results don't specifically address using Lgt itself for this purpose, they describe related approaches for antigen display in L. acidophilus that inform how Lgt-based systems might work.

Two different anchor motifs have been used to display Salmonella flagellin (FliC) on the surface of L. acidophilus:

• Cell envelope proteinase (PrtP) fusion: The antigen is fused to the C-terminal region of PrtP and bound to the cell wall by electrostatic bonds .

• Mucus binding protein (Mub) fusion: The antigen is conjugated to the anchor region of Mub and covalently associated with the cell wall by an LPXTG motif .

These two different display methods resulted in dissimilar maturation and cytokine production by human myeloid dendritic cells, indicating that the method of surface display significantly affects immunological outcomes .

For an Lgt-based system, researchers could potentially exploit the lipoprotein processing pathway by creating fusion proteins where the heterologous antigen is attached to a lipoprotein precursor containing an appropriate lipobox. The native Lgt would then process this fusion protein, resulting in the lipidated antigen being anchored to the cell membrane. This approach would leverage the natural lipoprotein processing machinery while allowing for surface display of foreign antigens.

What are the critical structural elements of Lgt required for its enzymatic activity?

Based on structural and functional studies of E. coli Lgt, several critical structural elements have been identified as essential for enzymatic activity:

• Conserved arginine residues: Complementation studies with lgt-knockout cells revealed that Arg143 and Arg239 are essential for diacylglyceryl transfer . These residues likely participate directly in substrate binding or catalysis.

• Multiple binding sites: Crystal structures of E. coli Lgt reveal the presence of two binding sites - one for phosphatidylglycerol (the acyl donor) and another likely for the lipobox-containing peptide (the acyl acceptor) .

• Membrane integration: As an integral membrane enzyme, Lgt contains multiple transmembrane domains that position it correctly within the lipid bilayer. This positioning is crucial for accessing lipid substrates within the membrane and for the proper orientation of catalytic residues .

• Lateral access: Structural evidence supports a mechanism whereby both substrate and product (lipid-modified lipobox-containing peptide) enter and leave the enzyme laterally relative to the lipid bilayer . This suggests that the enzyme must maintain channels or openings that permit lateral movement of substrates and products within the membrane.

While the specific structure of L. acidophilus Lgt has not been determined experimentally according to the provided search results, the high conservation of function among bacterial Lgts suggests that these critical elements are likely preserved across species.

What expression systems are optimal for producing recombinant L. acidophilus Lgt?

For the efficient production of recombinant L. acidophilus Lgt, several expression systems can be considered based on the properties of the protein and research requirements:

Lactobacillus expression systems: Homologous expression in Lactobacillus species may preserve native folding and activity. For this approach, shuttle vectors containing Lactobacillus-compatible origins of replication and selection markers are required. Inducible promoters such as the nisin-controlled expression system can be adapted for Lactobacillus species. Expression in the native host potentially allows for functional characterization in a physiologically relevant context .

Cell-free systems: For membrane proteins like Lgt, specialized cell-free systems supplemented with lipids or detergents may offer advantages in expressing functional protein. These systems bypass cell viability constraints and can be optimized for membrane protein production.

When producing recombinant L. acidophilus Lgt specifically for structural or enzymatic studies, the addition of appropriate detergents during extraction and purification is critical to maintain the native conformation and activity of the protein. Based on studies with E. coli Lgt, detergents like DDM (n-dodecyl β-D-maltoside) or LDAO (lauryldimethylamine oxide) have been successfully used to solubilize and purify functional Lgt enzyme .

How can the enzymatic activity of recombinant Lgt be measured in vitro?

Multiple complementary approaches can be used to measure the enzymatic activity of recombinant Lgt in vitro:

1. Phospholipid-peptide transfer assay:
This assay directly measures the transfer of diacylglyceryl from phosphatidylglycerol to a synthetic peptide containing the lipobox motif. The reaction components include:

• Purified recombinant Lgt

• Radiolabeled or fluorescently labeled phosphatidylglycerol

• Synthetic peptide substrate containing the [L/V/I]-[A/S/T]-[G/A]-C lipobox motif

• Appropriate buffer and detergent conditions

The reaction products can be separated by thin-layer chromatography or HPLC, and the modified peptide can be detected through radioactivity measurement or fluorescence scanning.

2. GFP-based in vitro assay:
A GFP-based assay has been used to correlate the activities of E. coli Lgt with structural observations . This could be adapted for L. acidophilus Lgt by:

• Creating a fusion protein of GFP and a lipobox-containing peptide

• Incubating this substrate with purified Lgt and phosphatidylglycerol

• Monitoring changes in GFP fluorescence properties or mobility on native PAGE upon lipidation

3. Mass spectrometry-based approaches:
Mass spectrometry provides precise characterization of lipidated products:

• LC-MS/MS can be used to detect the mass shift in peptide substrates after diacylglyceryl transfer

• This approach allows for detailed characterization of the lipid modifications and can distinguish between different acylation states

4. Complementation assays:
Functional activity can be assessed through complementation of lgt-knockout bacterial strains:

• Transform lgt-knockout cells with a plasmid expressing recombinant L. acidophilus Lgt

• Monitor restoration of lipoprotein processing through analysis of selected lipoproteins

• Assess phenotypic rescue of growth or other lgt-dependent phenotypes

The selection of an appropriate assay depends on the specific research questions and available resources. Combining multiple approaches provides more comprehensive characterization of Lgt enzymatic activity.

How can researchers create and verify lgt knockout strains in L. acidophilus?

Creating and verifying lgt knockout strains in L. acidophilus requires a systematic approach:

Construction of lgt knockout:

• Gene replacement strategy: The lgt gene can be replaced with a selectable marker through double crossover homologous recombination. Based on the approach used for L. plantarum, the lgt coding region can be replaced with a chloramphenicol acetyltransferase (cat) cassette . This requires:

  • Constructing a vector containing upstream and downstream homologous regions flanking the lgt gene

  • Inserting a selectable marker (e.g., cat gene for chloramphenicol resistance) between these flanking regions

  • Transforming L. acidophilus with the knockout construct

  • Selecting for double crossover events using appropriate antibiotics

• Alternative approach - CRISPR-Cas9: For more precise genome editing without antibiotic markers, CRISPR-Cas9 systems adapted for Lactobacillus can be employed:

  • Design sgRNA targeting the lgt gene

  • Provide a repair template with upstream and downstream homologous regions

  • Select for successful editing through screening

Verification methods:

• PCR verification: Design primers spanning the lgt locus to confirm replacement of the gene with the selection marker. Multiple primer pairs should be used to verify both integration of the marker and absence of the lgt gene.

• Whole genome sequencing: To rule out off-target effects and confirm the precise genetic modification.

• RT-PCR or RNA-seq: To verify the absence of lgt transcripts.

• Proteomic analysis: Mass spectrometry-based proteomic analysis can confirm the absence of the Lgt protein and monitor changes in the secreted proteome. In L. plantarum, lgt deletion led to the release of predicted lipoproteins that remained non-acylated , providing a characteristic proteomic signature.

• Phenotypic verification: While growth and cell morphology may be unaffected under laboratory conditions , immunomodulatory properties should be altered. Testing the mutant strain's ability to stimulate TLR2 signaling compared to wild-type can provide functional verification .

• Lipoprotein localization: Immunofluorescence microscopy using antibodies against known lipoproteins can verify altered localization in the lgt mutant.

This comprehensive verification approach ensures both genetic and functional confirmation of the lgt knockout, providing a reliable mutant strain for further research.

What approaches can be used to study Lgt-mediated immunomodulation?

Several complementary approaches can be employed to study Lgt-mediated immunomodulation:

1. Cell-based reporter assays:

• TLR2 reporter cell lines: HEK293 cells transfected with TLR2 and a reporter gene (e.g., luciferase) under the control of an NF-κB-responsive promoter can be used to measure TLR2 activation by wild-type versus lgt mutant bacteria .

• Distinguish between TLR1/2 and TLR2/6 signaling: Using specific reporter cell lines for each heterodimer can determine which receptor complex is primarily activated by L. acidophilus lipoproteins .

2. Primary immune cell culture:

• Dendritic cell assays: Human myeloid dendritic cells can be cultured with wild-type or lgt-mutant bacteria to assess differences in maturation and cytokine production .

• Macrophage response: Measure phagocytosis rates, cytokine production, and gene expression changes in macrophages exposed to wild-type versus lgt-mutant bacteria.

• T cell polarization: Co-culture dendritic cells exposed to different bacterial strains with naïve T cells to assess Th1/Th2/Th17/Treg differentiation.

3. Cytokine profiling:

• ELISA or multiplex assays to quantify cytokine production (IL-6, IL-10, IL-12, TNF-α, etc.) in response to wild-type versus lgt-mutant bacteria.

• Intracellular cytokine staining and flow cytometry to identify specific immune cell populations responding to bacterial stimulation.

4. Transcriptomic and proteomic analysis:

• RNA-seq of immune cells exposed to wild-type versus lgt-mutant bacteria to identify differentially regulated genes and pathways.

• Phosphoproteomic analysis to identify differences in signaling cascades activated by the different bacterial strains.

5. In vivo models:

• Gnotobiotic mouse models: Compare immune responses to wild-type versus lgt-mutant bacteria in mice with controlled microbiota.

• Tissue-specific responses: Analyze immune cell populations and cytokine profiles in intestinal tissues after oral administration of different bacterial strains.

• Disease models: Assess protective effects of wild-type versus lgt-mutant bacteria in models of inflammatory bowel disease, allergic sensitization, or pathogen challenge.

6. Purified lipoprotein studies:

• Isolate and purify individual lipoproteins from wild-type bacteria and test their immunomodulatory properties in isolation.

• Compare with the same proteins expressed in lgt-mutant bacteria (non-lipidated forms) to determine the specific contribution of lipid modifications to immune activation.

These approaches provide a comprehensive framework for understanding how Lgt-dependent lipoprotein modifications influence host-microbe interactions and immune responses, with particular relevance to the probiotic properties of L. acidophilus.

How should recombinant Lgt be stored to maintain its stability and activity?

Proper storage of recombinant L. acidophilus Lgt is critical for maintaining its stability and enzymatic activity. Based on general principles for membrane proteins and specific information from the search results, the following storage conditions are recommended:

Short-term storage (up to one week):

• Store working aliquots at 4°C

• Use a Tris-based buffer optimized for the specific protein

• Include 50% glycerol to enhance stability

Long-term storage:

• Store at -20°C for extended periods

• For maximum longevity, store at -80°C

• Avoid repeated freeze-thaw cycles, as this is not recommended for maintaining activity

• Prepare small single-use aliquots to minimize freeze-thaw events

Buffer components to consider:

• Tris-based buffer at physiological pH (7.4-8.0)

• Include glycerol (50%) as a cryoprotectant

• Consider adding reducing agents like DTT or β-mercaptoethanol to prevent oxidation of cysteine residues

• For membrane proteins like Lgt, appropriate detergents at concentrations above their critical micelle concentration are essential to maintain native conformation

• Protease inhibitors may be added to prevent degradation

Additional considerations:

• Validate protein stability under storage conditions by measuring enzymatic activity after various storage periods

• Consider lyophilization as an alternative for very long-term storage, though this requires optimization for membrane proteins

• For applications requiring high purity and activity, freshly purified protein may be preferable to stored samples

When recovering the protein from storage, allow frozen aliquots to thaw completely on ice before use, and centrifuge briefly to collect any condensation. For applications requiring maximum enzymatic activity, it may be beneficial to verify protein function after thaw using one of the activity assays described previously.