Recombinant Lactobacillus acidophilus Protein CrcB homolog 1 (crcB1)

Shipped with Ice Packs
In Stock

Description

Functional Roles of CrcB Homologs

CrcB proteins are hypothesized to mitigate fluoride toxicity by exporting intracellular fluoride ions. This mechanism is crucial for bacterial survival in fluoride-rich environments (e.g., oral cavities or acidic niches). Key functional insights from related species include:

  • Fluoride Resistance: CrcB homologs in L. salivarius and L. johnsonii enhance fluoride tolerance, enabling bacterial persistence in hostile environments .

  • Stress Adaptation: Surface-layer proteins (SLPs) in L. acidophilus (e.g., SlpA) are essential for stress tolerance and host interactions , suggesting CrcB1 may similarly contribute to environmental resilience.

Recombinant Production and Applications

Recombinant CrcB1 proteins are produced in E. coli systems for structural and functional studies:

  • Expression and Purification:

    • Proteins are expressed with N-terminal His tags for affinity chromatography.

    • Lyophilized powders retain stability at -80°C but degrade with repeated freeze-thaw cycles .

  • Potential Applications:

    • Probiotic Engineering: Enhancing fluoride resistance in L. acidophilus strains for oral health applications.

    • Mechanistic Studies: Investigating ion transport mechanisms in lactic acid bacteria.

Research Gaps and Future Directions

Current limitations highlight opportunities for further study:

  • Functional Validation: Direct evidence of CrcB1’s role in L. acidophilus is lacking. Knockout studies could clarify its contribution to fluoride efflux.

  • Structural Analysis: Cryo-EM or X-ray crystallography of L. acidophilus CrcB1 would elucidate ion channel architecture.

  • Biotechnological Optimization: Improving protein yield and stability for industrial applications.

Comparative Genomic Insights

Comparative genomics of L. acidophilus strains reveals variability in stress-response operons (e.g., CRISPR-Cas systems, bacteriocin production) . While CrcB1 is not explicitly mentioned, its homologs’ conservation across Lactobacillus species implies a conserved role in environmental adaptation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Specify your desired tag type during ordering for preferential development.
Synonyms
crcB1; LBA0992; Putative fluoride ion transporter CrcB 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-129
Protein Length
full length protein
Species
Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Target Names
crcB1
Target Protein Sequence
MSTKTGNYISIAIFAFFGGIARAWLNSSFGFYGTFWGNIIGCFLLAFFTYLFMEFKDVRQ WLTVGLGTGFVGAFTTFSTFNLDVLKNIQANVPITALIYFLSSIIFGFCFAYLGMNAGKQ VGNLLRKED
Uniprot No.

Target Background

Function

Crucial for reducing intracellular fluoride concentration and its associated toxicity.

Database Links

KEGG: lac:LBA0992

STRING: 272621.LBA0992

Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is CrcB homolog 1 in Lactobacillus acidophilus?

CrcB homolog 1 (crcB1) is a protein found in Lactobacillus acidophilus that belongs to the CrcB protein family. This protein family is typically associated with fluoride ion transport or resistance mechanisms in bacteria. In L. acidophilus, which is naturally found in the mouth, intestine, and vagina, crcB1 may play roles in maintaining cellular homeostasis and potentially contributing to probiotic properties. The protein's exact function in L. acidophilus specifically must be determined through targeted research methodologies, including gene knockout studies, protein localization experiments, and functional assays .

How does recombinant expression of crcB1 differ from native expression?

Recombinant expression of crcB1 involves the insertion of the crcB1 gene into an expression vector system that can be transformed into L. acidophilus or another host organism. This differs from native expression in several key ways: recombinant expression typically results in higher protein yields, can include fusion tags for purification, and may place the gene under the control of inducible promoters for regulated expression. Native expression is regulated by the bacterium's own genetic control mechanisms and occurs at physiological levels appropriate for normal cellular function. When designing recombinant expression studies, researchers should consider how modifications might affect protein folding, function, and stability compared to the native form .

What expression vectors are suitable for recombinant crcB1 production in Lactobacillus?

Several expression vectors have been developed specifically for Lactobacillus species. Based on research with similar systems, suitable vectors would include those with strong, constitutive promoters like the lactate dehydrogenase (ldh) promoter or inducible systems like the nisin-controlled expression system. When selecting a vector, researchers should consider compatibility with L. acidophilus, appropriate selection markers (typically antibiotic resistance genes), and whether secretion signals are needed if protein export is desired. The vector used for protein delivery in L. reuteri described in previous studies could be adapted for crcB1 expression in L. acidophilus with appropriate modifications to account for species-specific differences in codon usage and regulatory elements .

How can I optimize codon usage for efficient crcB1 expression in Lactobacillus acidophilus?

Optimizing codon usage for crcB1 expression in L. acidophilus requires analysis of the organism's preferred codons. Start by analyzing the codon usage bias in highly expressed L. acidophilus genes using tools like the Codon Usage Database or specialized software like OPTIMIZER. Replace rare codons in the crcB1 sequence with synonymous codons that are more frequently used in L. acidophilus. Specially, avoid rare codons near the 5' end of the gene, as these can impede translation initiation. Consider synthesizing the entire gene with optimized codons rather than making individual substitutions. After optimization, validate expression levels by comparing protein yields between optimized and non-optimized constructs using Western blot analysis with appropriate antibodies against crcB1 or attached fusion tags .

What purification methods are most effective for recombinant crcB1 protein?

The most effective purification methods for recombinant crcB1 depend on the expression system and any fusion tags incorporated into the protein. A systematic approach to crcB1 purification would typically involve:

  • Cell lysis using methods gentle enough to preserve protein structure (sonication or enzymatic lysis)

  • Initial clarification steps (centrifugation, filtration)

  • Affinity chromatography if fusion tags are present (His-tag, GST, etc.)

  • Ion exchange chromatography based on crcB1's predicted isoelectric point

  • Size exclusion chromatography as a polishing step

For membrane-associated proteins like crcB1, detergent selection during extraction is critical. Test multiple detergents (e.g., DDM, CHAPS, Triton X-100) at various concentrations to optimize solubilization while maintaining protein function. Validation of purification success should include SDS-PAGE, Western blotting, and functional assays specific to crcB1's predicted ion transport activity .

What analytical techniques should be used to verify correct folding of recombinant crcB1?

Verifying correct folding of recombinant crcB1 requires multiple complementary analytical techniques:

Analytical TechniqueInformation ProvidedExperimental Conditions
Circular Dichroism (CD)Secondary structure content (α-helix, β-sheet)Far-UV (190-250 nm) for secondary structure; Near-UV (250-350 nm) for tertiary structure
Fluorescence SpectroscopyTertiary structure, tryptophan environmentExcitation at 280 nm, emission scan 300-400 nm
Size Exclusion ChromatographyOligomeric state, aggregationBuffer compatible with protein stability
Thermal Shift AssayProtein stability, ligand bindingTemperature gradient with fluorescent dye
Limited ProteolysisDomain structure, flexible regionsControlled enzyme:protein ratios

Most critically, functional assays specific to crcB1's predicted function (such as fluoride transport assays) should be performed to confirm that the recombinant protein maintains its biological activity. Comparison to activity levels in native L. acidophilus membranes can provide benchmarks for proper folding .

How can I design a CRISPR-Cas9 system to study crcB1 function in Lactobacillus acidophilus?

Designing a CRISPR-Cas9 system for studying crcB1 function in L. acidophilus requires careful consideration of several factors. First, select appropriate promoters for Cas9 and guide RNA expression that function efficiently in L. acidophilus. The lactate dehydrogenase promoter has shown good activity in Lactobacillus species. Design guide RNAs targeting multiple regions of the crcB1 gene using tools like CHOPCHOP or CRISPR-direct, and verify their specificity across the L. acidophilus genome to minimize off-target effects. Incorporate a selection marker (like antibiotic resistance) to identify transformed cells, and consider using homology-directed repair templates to introduce specific mutations or reporter genes.

For delivery, electroporation protocols optimized for L. acidophilus typically yield the best transformation efficiency. After transformation, screen candidates using PCR, sequencing, and phenotypic assays to verify successful editing. To assess the functional consequences of crcB1 knockout or modification, evaluate growth under varying fluoride concentrations, measure fluoride uptake using fluoride-selective electrodes, and analyze transcriptomic changes using RNA-seq to identify compensatory mechanisms .

What are the challenges in developing Lactobacillus acidophilus as a vector for delivering recombinant crcB1 to different body sites?

Developing L. acidophilus as a delivery vector for recombinant crcB1 faces several significant challenges:

  • Genetic stability: Maintaining stable expression of crcB1 over multiple generations requires careful vector design. Researchers should assess plasmid stability through continuous culture experiments, monitoring retention of the expression construct over at least 400-500 generations using antibiotic selection pressure and PCR verification .

  • Colonization persistence: L. acidophilus must effectively colonize target sites to deliver crcB1 protein. Studies show varying colonization efficiency depending on administration route and competing microbiota. Tracking methods include selective plating of fecal/tissue samples and quantitative PCR of strain-specific markers .

  • Controlled expression: Designing expression systems that activate at specific body sites requires site-responsive promoters. Options include pH-responsive promoters for intestinal delivery or quorum-sensing responsive elements for density-dependent expression.

  • Protein secretion efficiency: If crcB1 function requires secretion, optimization of signal peptides is critical. Comparative analysis of multiple signal sequences from well-secreted Lactobacillus proteins should be conducted using quantitative Western blot analysis of culture supernatants versus cell lysates .

  • Regulatory considerations: For in vivo applications, genetic containment strategies may be required, such as auxotrophic mutations or toxin-antitoxin systems that prevent environmental persistence.

How does crcB1 function compare between different Lactobacillus species, and what techniques can elucidate these differences?

Comparing crcB1 function across Lactobacillus species requires multiple comparative approaches:

  • Bioinformatic analysis: Perform phylogenetic analysis of crcB1 homologs across Lactobacillus species to identify conserved domains and species-specific variations. Use protein structure prediction tools like AlphaFold to model structural differences that might influence function.

  • Heterologous expression: Express crcB1 from different Lactobacillus species in a common host (like E. coli) using identical expression systems, then compare protein yields, stability, and functional parameters in standardized assays.

  • Complementation studies: Test whether crcB1 from different species can complement function in a crcB1-knockout strain of L. acidophilus. Create a fluoride-sensitivity assay measuring growth inhibition at various fluoride concentrations before and after complementation.

  • Domain swapping experiments: Create chimeric proteins containing domains from crcB1 of different species to identify which regions are responsible for species-specific functional differences.

  • In situ localization: Use fluorescent protein fusions or immunolocalization to determine if crcB1 localizes differently within cells of different Lactobacillus species, potentially indicating functional adaptations.

The combined results from these approaches can elucidate evolutionary adaptations in crcB1 function across the Lactobacillus genus .

What real-time PCR protocols are most suitable for quantifying crcB1 expression in Lactobacillus acidophilus?

For quantifying crcB1 expression in L. acidophilus, SYBR Green-based real-time PCR protocols offer cost-effective and specific quantification. The following protocol is adapted from established methodologies for similar genes:

  • RNA extraction: Use Trizol reagent (Invitrogen) followed by DNase treatment to eliminate genomic DNA contamination. Verify RNA quality using spectrophotometric analysis (A260/A280 ratio >1.8) and gel electrophoresis.

  • cDNA synthesis: Perform reverse transcription using a Rever Tra Ace qPCR RT Kit (Toyobo) or similar commercial kit with oligo(dT) and random primers for comprehensive coverage.

  • Primer design: Design crcB1-specific primers with the following characteristics:

    • Amplicon length: 80-150 bp

    • Primer length: 18-25 nucleotides

    • GC content: 40-60%

    • Melting temperature: 58-62°C

    • Specificity verified by BLAST against the L. acidophilus genome

  • Reference gene selection: Use multiple reference genes for normalization, such as 16S rRNA, rpoB, and gyrB, analyzing stability with algorithms like geNorm or NormFinder.

  • qPCR reaction: Perform in a Bio-Rad CFX96 or similar system using 10-μl SYBR Green Real-time PCR Master Mix (Roche), with cycling conditions: initial denaturation at 95°C for 10 min, followed by 40 cycles of 95°C for 15 s and 60°C for 60 s.

  • Data analysis: Use the 2^-ΔΔCt method for relative quantification, including technical triplicates and biological replicates (minimum n=3) .

How can I determine if mutations in crcB1 affect the probiotic properties of Lactobacillus acidophilus?

Determining the effect of crcB1 mutations on L. acidophilus probiotic properties requires a multi-faceted approach evaluating key probiotic characteristics:

  • Acid and bile tolerance: Compare growth of wild-type and crcB1 mutant strains in media adjusted to pH 2.0-5.0 and supplemented with 0.1-0.5% bile salts. Monitor survival rates over time (0, 2, 4, 6 hours) using plate counts.

  • Adhesion to intestinal epithelial cells: Use Caco-2 or HT-29 cell lines in adhesion assays. Incubate labeled bacteria with cell monolayers, wash to remove non-adherent bacteria, and quantify adhered bacteria through plate counts or fluorescence measurements.

  • Antimicrobial activity: Assess production of antimicrobial compounds using agar diffusion assays against indicator strains like Escherichia coli, Salmonella enterica, and Clostridium perfringens. Compare inhibition zone diameters between wild-type and mutant strains.

  • Immunomodulatory effects: Co-culture wild-type and mutant strains with immune cells (like THP-1 derived macrophages) and measure cytokine production (IL-10, IL-12, TNF-α) by ELISA.

  • Competitive exclusion: Assess the ability to prevent pathogen adhesion by pre-incubating epithelial cells with wild-type or mutant L. acidophilus before challenging with pathogens like C. perfringens.

  • Fluoride resistance: Since crcB1 may be involved in fluoride transport, compare growth of wild-type and mutant strains in media with varying fluoride concentrations (0-20 mM), which may reveal connections between fluoride resistance and other probiotic properties .

How can transcriptomic analysis help understand the regulatory network involving crcB1 in Lactobacillus acidophilus?

Transcriptomic analysis provides powerful insights into the regulatory network involving crcB1 in L. acidophilus. RNA-seq is the preferred method for comprehensive transcriptome profiling. Experimental design should include appropriate conditions that might affect crcB1 expression, such as varying fluoride concentrations, pH changes, and different growth phases.

After sequencing, bioinformatic analysis should include:

  • Differential expression analysis to identify genes co-regulated with crcB1 under different conditions using tools like DESeq2 or edgeR.

  • Cluster analysis to group genes with similar expression patterns, potentially revealing functional relationships.

  • Promoter analysis of co-regulated genes to identify common regulatory motifs, suggesting shared transcription factors.

  • Network construction using algorithms like WGCNA (Weighted Gene Co-expression Network Analysis) to build gene regulatory networks.

  • Pathway enrichment analysis to identify biological processes associated with crcB1 regulation.

To validate key findings, researchers should perform targeted experiments such as:

  • Chromatin immunoprecipitation (ChIP) to identify transcription factors binding to the crcB1 promoter

  • Reporter gene assays to verify predicted regulatory elements

  • RT-qPCR validation of expression patterns for selected genes

This approach can reveal master regulators controlling crcB1 expression and position crcB1 within the broader regulatory architecture of L. acidophilus .

What proteomics methods can best characterize the interaction partners of crcB1 in Lactobacillus acidophilus?

For characterizing crcB1 interaction partners in L. acidophilus, several complementary proteomics approaches provide the most comprehensive results:

MethodApplicationAdvantagesLimitations
Co-immunoprecipitation with LC-MS/MSIdentify direct interacting proteinsPreserves physiological interactionsRequires specific antibodies or tagged protein
Proximity labeling (BioID or APEX)Capture transient or weak interactionsWorks in native conditionsMay identify nearby non-interacting proteins
Cross-linking mass spectrometryMap interaction interfacesIdentifies direct contact pointsComplex data analysis
Membrane yeast two-hybridScreen for membrane protein interactionsSpecific for membrane proteinsFalse positives/negatives

For co-immunoprecipitation studies, express crcB1 with an affinity tag (e.g., FLAG or HA) in L. acidophilus, lyse cells under conditions that preserve protein interactions (mild detergents), and purify using tag-specific antibodies. The resulting protein complexes can be analyzed by LC-MS/MS to identify interacting partners.

Data analysis should include appropriate controls (non-specific antibodies or untagged strains) and statistical filtering to remove common contaminants. Validation of key interactions should be performed using reciprocal co-immunoprecipitation, FRET/BRET assays, or in vitro binding studies with purified proteins. Functional significance of identified interactions can be assessed through mutational studies targeting interaction interfaces .

How can I assess the stability of recombinant crcB1 expression in Lactobacillus acidophilus under simulated gastrointestinal conditions?

Assessing the stability of recombinant crcB1 expression in L. acidophilus under simulated gastrointestinal conditions requires a multi-step approach that mimics transit through the digestive system:

  • Construct stability: First, evaluate the genetic stability of the crcB1 expression construct by continuous culture of the recombinant strain for multiple generations (at least 400-500 generations) without selection pressure, periodically testing for retention of the expression construct by PCR and functional assays .

  • Simulated gastric fluid exposure: Prepare simulated gastric fluid (SGF) containing pepsin (3.2 mg/mL) in 0.2% NaCl at pH 2.0. Incubate recombinant L. acidophilus in SGF for 0, 30, 60, and 120 minutes at 37°C. At each timepoint, collect samples for:

    • Viability assessment via plate counting

    • RNA extraction and RT-qPCR for crcB1 mRNA quantification

    • Protein extraction and Western blot for crcB1 protein detection

  • Simulated intestinal fluid exposure: Transfer surviving bacteria to simulated intestinal fluid (SIF) containing pancreatin (10 mg/mL) and bile salts (0.3%) at pH 7.0. Continue sampling as above for 0, 1, 3, and 6 hours.

  • Sequential exposure system: For more realistic assessment, use a dynamic model that sequentially exposes bacteria to changing conditions mimicking the entire GI tract, such as:

    • Mouth phase (amylase, pH 7.0, 2 min)

    • Esophagus-stomach phase (decreasing pH to 2.0 over 2 hours)

    • Small intestine phase (increasing pH to 6.5-7.5, bile, pancreatic enzymes, 4 hours)

    • Large intestine phase (pH 6.7, reduced oxygen, 18-24 hours)

  • In vivo validation: Ultimately, confirm findings using animal models (typically mice) by oral administration of the recombinant strain, followed by collection of intestinal contents at different timepoints for analysis of bacterial recovery, plasmid retention, and crcB1 expression .

What techniques can be used to study potential horizontal gene transfer of the recombinant crcB1 construct to other gut microbiota?

Investigating potential horizontal gene transfer (HGT) of recombinant crcB1 constructs to other gut microbiota is essential for biosafety assessment. A comprehensive approach includes:

  • In vitro conjugation experiments: Co-culture the recombinant L. acidophilus strain with potential recipient bacteria (including representatives from Enterobacteriaceae, Bacteroidetes, and other gut commensals) under conditions promoting conjugation. Use selective media to isolate potential transconjugants, followed by PCR verification of the transferred construct.

  • Filter mating assays: Place donor and recipient cells together on membrane filters on non-selective media, allowing close cell-to-cell contact. After incubation, plate on selective media to identify transconjugants.

  • Transformation frequency assessment: Prepare DNA from the recombinant strain and incubate with potential naturally competent gut bacteria under transformation-promoting conditions. Quantify transformation frequency by selective plating and PCR verification.

  • In vivo studies: Administer recombinant L. acidophilus to gnotobiotic mice with defined gut microbiota. Collect fecal samples over time and perform:

    • Selective plating for potential transconjugants

    • qPCR targeting the recombinant construct in total community DNA

    • Shotgun metagenomics to detect construct integration in other species

  • Advanced detection methods:

    • Fluorescent reporter systems where the recombinant construct contains a fluorescent protein gene

    • Epicollection PCR using primers specific to the construct and recipient bacterial genome

    • Single-cell approaches like flow cytometry with fluorescence in situ hybridization (FLOW-FISH) to directly visualize potential transfer events

Data analysis should include careful calculation of transfer frequencies under different conditions and identification of factors that might influence transfer rates .

How can functional differences between wild-type and recombinant crcB1 be assessed in in vitro and in vivo models?

Assessing functional differences between wild-type and recombinant crcB1 requires systematic comparison across multiple parameters:

In vitro assessments:

In vivo assessments:

  • Colonization studies: Compare the ability of L. acidophilus strains expressing wild-type versus recombinant crcB1 to colonize the gastrointestinal tract of animal models. Quantify bacteria in different intestinal segments over time.

  • Protection assays: If crcB1 contributes to stress resistance (particularly fluoride resistance), challenge animals colonized with different strains with fluoride-containing water and monitor colonization persistence.

  • Impact on host physiology: Analyze physiological parameters in colonized animals, including:

    • Immune cell populations in gut-associated lymphoid tissue

    • Cytokine profiles in intestinal tissue

    • Gut barrier integrity measurements

    • Microbiome composition analysis

  • Functional genomics approach: Perform RNA-seq on intestinal tissue from animals colonized with different strains to identify host response differences.

Statistical analysis should include appropriate tests for significance (t-tests, ANOVA) with corrections for multiple comparisons where applicable. Multivariate analyses like principal component analysis can help identify patterns in complex datasets from in vivo experiments .

Why might recombinant crcB1 show lower expression levels than expected in Lactobacillus acidophilus?

Low expression levels of recombinant crcB1 in L. acidophilus can result from multiple factors. A systematic troubleshooting approach includes:

  • Genetic factors:

    • Codon optimization issues: Analyze the crcB1 sequence for rare codons in L. acidophilus. Particularly check the first 50 nucleotides after the start codon, as rare codons here can significantly impact translation initiation.

    • Secondary structure in mRNA: Predict mRNA secondary structures using tools like Mfold. Strong secondary structures near the ribosome binding site can impede translation initiation. Modify sequences to reduce stable structures.

    • Promoter strength: Evaluate promoter activity using reporter genes like β-galactosidase. Consider testing alternative promoters with different strengths.

  • Protein factors:

    • Protein toxicity: If crcB1 overexpression is toxic, implement tightly regulated inducible systems or decrease expression strength.

    • Proteolytic degradation: Add protease inhibitors during extraction or co-express with chaperones to improve stability.

    • Membrane protein overload: For membrane proteins like crcB1, excessive production can saturate membrane insertion machinery. Reduce expression levels or co-express with insertion machinery components.

  • Methodological factors:

    • Detection limitations: Ensure antibodies or tags have sufficient sensitivity. Consider using more sensitive detection methods like mass spectrometry.

    • Extraction efficiency: Optimize membrane protein extraction protocols using different detergents and buffer conditions.

    • Growth conditions: Test different media compositions, temperatures, and growth phases for optimal expression.

Implement a systematic approach by changing one variable at a time and quantifying expression levels using Western blotting or targeted proteomics. Document all conditions tested in a structured format to identify patterns that might reveal the underlying issue .

What strategies can overcome poor solubility when purifying recombinant crcB1?

Overcoming poor solubility of recombinant crcB1 requires a multi-faceted approach targeting different aspects of protein production and purification:

  • Expression optimization:

    • Fusion partners: Test solubility-enhancing fusion partners such as MBP (maltose-binding protein), SUMO, or Thioredoxin. These can be later removed with specific proteases if necessary.

    • Reduced expression rate: Lower induction temperatures (16-25°C) and reduced inducer concentrations can improve folding by slowing synthesis rate.

    • Co-expression with chaperones: Co-express with chaperone systems like GroEL/ES, DnaK/DnaJ/GrpE, or specific Lactobacillus chaperones.

  • Extraction optimization:

DetergentWorking ConcentrationCharacteristics
DDM0.5-1%Mild, maintains function
CHAPS0.5-1%Zwitterionic, good for functional studies
Digitonin0.5-1%Very mild, preserves protein-protein interactions
SDS0.1-0.5%Harsh, good for complete solubilization
Triton X-1000.5-1%Intermediate strength

Perform a detergent screening experiment testing each detergent at multiple concentrations, analyzing solubilization efficiency by SDS-PAGE and Western blotting.

  • Buffer optimization:

    • Screen buffer pH range (6.0-9.0) and ionic strength (50-500 mM)

    • Test various additives: glycerol (5-20%), arginine (50-500 mM), sucrose (5-10%), specific lipids

    • Include stabilizers like cholesterol hemisuccinate for membrane proteins

  • Alternative approaches:

    • Cell-free expression systems which can directly incorporate detergents or lipids

    • Amphipol or nanodiscs as alternatives to detergents

    • On-column refolding protocols where denatured protein is gradually refolded during purification

  • Validation methods:

    • Analytical size exclusion chromatography to assess aggregation state

    • Thermal shift assays to identify stabilizing conditions

    • Activity assays to ensure solubilized protein retains function

Document conditions systematically, as combinations of factors rather than single variables often provide the solution to solubility issues .

How might CRISPR-based techniques be applied to study crcB1 regulation networks in Lactobacillus acidophilus?

CRISPR-based techniques offer powerful approaches for studying crcB1 regulation networks in L. acidophilus:

  • CRISPRi (CRISPR interference): Using catalytically inactive Cas9 (dCas9) fused to a repressor domain allows targeted downregulation of crcB1 expression without genomic modification. This approach can be extended to potential regulators identified through transcriptomics to map the regulatory network. The system requires:

    • Codon-optimized dCas9 for L. acidophilus

    • A repressor domain like KRAB that functions in bacterial systems

    • Guide RNAs targeting the crcB1 promoter or potential regulator promoters

  • CRISPRa (CRISPR activation): Similar to CRISPRi but using activator domains fused to dCas9 to upregulate gene expression. This can help identify genes whose increased expression affects crcB1 regulation.

  • CRISPR-mediated base editing: Using Cas9 fused to cytidine or adenine deaminases allows precise modification of specific bases without double-strand breaks. This enables systematic mutation of potential regulatory sequences in the crcB1 promoter to identify critical elements.

  • CRISPR scanning: Systematic targeting of non-coding regions around the crcB1 gene with multiple guides to identify regulatory elements based on phenotypic changes.

  • Multiplexed CRISPR approaches: Simultaneously targeting multiple genes to study combinatorial effects and identify synthetic interactions within the regulatory network.

Implementation would require optimization of L. acidophilus transformation protocols and careful design of guide RNAs to ensure specificity. Phenotypic readouts should include crcB1 expression levels (using reporter genes or RT-qPCR), growth under various conditions, and fluoride sensitivity assays .

What emerging technologies could enhance our understanding of crcB1 structure-function relationships?

Several cutting-edge technologies are poised to revolutionize our understanding of crcB1 structure-function relationships:

  • Cryo-electron microscopy (Cryo-EM): Rapid advances in cryo-EM technology now enable determination of membrane protein structures at near-atomic resolution without crystallization. Single-particle cryo-EM can reveal crcB1's native structure in different conformational states, particularly important for understanding ion transport mechanisms.

  • AlphaFold2 and RoseTTAFold: These AI-based protein structure prediction methods can generate highly accurate structural models of crcB1, which can be validated and refined with experimental data. These models can guide mutagenesis studies by identifying critical residues and predicting effects of mutations.

  • Molecular dynamics simulations: Using structural models as starting points, advanced simulations can reveal dynamic aspects of crcB1 function, including ion permeation pathways, conformational changes during transport, and interactions with membrane lipids.

  • Single-molecule FRET: By labeling specific residues in crcB1 with fluorophore pairs, conformational changes during function can be directly observed in real-time, providing insights into the dynamics of transport mechanisms.

  • Deep mutational scanning: This approach involves creating thousands of crcB1 variants with different mutations and assessing their function in parallel using next-generation sequencing. This generates comprehensive maps of how each residue contributes to protein function.

  • In-cell NMR spectroscopy: This emerging technique allows structural and dynamic studies of proteins directly in living cells, providing insights into how the cellular environment affects crcB1 structure and function.

  • Nanobody-aided structural biology: Using nanobodies to stabilize specific conformations of crcB1 can facilitate structural studies of transient states that might otherwise be difficult to capture.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.