Recombinant Lactobacillus acidophilus UPF0397 protein LBA0922 (LBA0922)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
LBA0922; UPF0397 protein LBA0922
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-185
Protein Length
full length protein
Species
Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Target Names
LBA0922
Target Protein Sequence
MNNTGLSVKKVVAIGIGSAIYVILARFTSIPTPIPNTNIELVFPFLAFFASIYGATVGFS VGFIGHALSDFIMYGQTWWSWVLATGILGWIIGLAYKRLDLKNGIFGLKQIILFNIVQII ANILAWIVVAPIGDIIIYSEPANKVFVQGISATISNGISILIIGTILLKAYASTKIKKGS LRKED
Uniprot No.

Target Background

Database Links

KEGG: lac:LBA0922

STRING: 272621.LBA0922

Protein Families
UPF0397 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are most effective for producing functional Recombinant Lactobacillus acidophilus UPF0397 protein LBA0922?

While E. coli remains the predominant expression system for Recombinant Lactobacillus acidophilus UPF0397 protein LBA0922 , researchers should consider several methodological factors:

  • Vector selection: pET expression systems with T7 promoters often yield high expression levels for bacterial proteins.

  • E. coli strain optimization: BL21(DE3) derivatives offer reduced protease activity and enhanced expression of membrane-associated proteins.

  • Induction conditions: Optimizing IPTG concentration (typically 0.1-1.0 mM) and induction temperature (often lowered to 16-25°C for membrane proteins) significantly impacts functional protein yield.

  • Solubility enhancement: Co-expression with chaperone proteins or fusion with solubility-enhancing tags may improve yields of functionally active protein.

The effectiveness of expression must be validated through activity assays relevant to the protein's known or hypothesized functions .

What are the optimal storage conditions for maintaining stability of Recombinant Lactobacillus acidophilus UPF0397 protein LBA0922?

Maintaining optimal stability of Recombinant Lactobacillus acidophilus UPF0397 protein LBA0922 requires adherence to specific storage protocols:

Storage FormTemperatureBufferAdditivesDuration
Lyophilized-20°C to -80°CN/AN/ALong-term (>1 year)
Reconstituted-80°CTris-based buffer50% glycerol6-12 months
Working aliquots4°CTris/PBS-based buffer6% Trehalose, pH 8.0Up to 1 week

Critical methodological considerations include:

  • Aliquoting immediately after reconstitution to minimize freeze-thaw cycles

  • Brief centrifugation of vials before opening to bring contents to the bottom

  • Avoiding repeated freeze-thaw cycles which significantly compromise protein integrity

  • Using sterile technique during all handling procedures

What reconstitution protocol maximizes the activity of lyophilized Recombinant Lactobacillus acidophilus UPF0397 protein LBA0922?

For optimal reconstitution and preservation of Recombinant Lactobacillus acidophilus UPF0397 protein LBA0922 activity, follow this methodological approach:

  • Initial preparation: Centrifuge the vial briefly before opening to collect all material at the bottom.

  • Reconstitution medium: Use deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL. For membrane-associated proteins like LBA0922, consider adding non-ionic detergents (0.1% n-dodecyl β-D-maltoside or similar) if downstream applications require the protein in solution.

  • Glycerol addition: Add glycerol to a final concentration of 5-50% (optimal: 50%) to prevent damage during freeze-thaw cycles.

  • Aliquoting strategy: Divide into single-use aliquots based on your experimental needs to minimize repeated freeze-thawing.

  • Storage after reconstitution: Store aliquots at -20°C/-80°C for long-term storage, or at 4°C for up to one week for active experiments .

This protocol maintains protein structural integrity and functional activity while minimizing degradation from environmental factors.

How should treatment and control groups be designed when evaluating Recombinant Lactobacillus acidophilus UPF0397 protein LBA0922 in functional assays?

When designing rigorous experimental protocols to evaluate Recombinant Lactobacillus acidophilus UPF0397 protein LBA0922 function, implement the following control structure:

  • Negative controls:

    • Buffer-only controls to account for buffer effects

    • Irrelevant protein controls (similar molecular weight, similar tag) to distinguish specific from non-specific effects

    • Heat-inactivated LBA0922 to differentiate between structural and functional effects

  • Positive controls:

    • Well-characterized proteins with known effects in your assay system

    • Different concentrations of LBA0922 to establish dose-dependency

  • Technical considerations:

    • Randomization of sample processing and analysis to minimize bias

    • Blinding of experimental groups during analysis when possible

    • Inclusion of internal standards for normalization

  • Validation controls:

    • Tag-free versions of the protein to assess tag interference

    • Alternative recombinant sources to verify consistency

This comprehensive control structure enables robust differentiation between specific LBA0922 effects and experimental artifacts.

What experimental design (between-subjects vs. within-subjects) is most appropriate for studies involving Recombinant Lactobacillus acidophilus UPF0397 protein LBA0922?

The selection between between-subjects and within-subjects designs for LBA0922 research depends on specific experimental contexts:

Design AspectBetween-Subjects DesignWithin-Subjects Design
AdvantagesNo cross-contamination between conditions; Eliminates order effects; Suitable for terminal experimentsRequires fewer subjects; Increased statistical power; Controls for individual variability
DisadvantagesHigher subject numbers required; Individual variability may mask effectsPotential carry-over effects; May require washout periods; Not suitable for terminal assays
Best Used ForTerminal cellular assays; Proteomics studies; Long-term exposuresReversible biochemical assays; Binding studies; Concentration-response experiments

For LBA0922 specifically, consider:

  • Use between-subjects designs for:

    • Cell-based assays examining membrane integrity changes

    • Immunological response measurements

    • Protein-protein interaction networks altered by LBA0922

  • Use within-subjects designs for:

    • Enzyme kinetic studies with LBA0922

    • Reversible binding assays

    • Comparative potency studies against related proteins

The experimental question and specific assay constraints should ultimately guide design selection.

What are the predicted functional properties of Recombinant Lactobacillus acidophilus UPF0397 protein LBA0922 based on structural analysis?

Structural analysis of Recombinant Lactobacillus acidophilus UPF0397 protein LBA0922 suggests several potential functional properties:

  • Membrane association: The amino acid sequence reveals multiple hydrophobic regions (particularly residues 12-34, 60-82, and 110-132) suggesting transmembrane domains consistent with membrane localization.

  • Transport functionality: The sequence pattern "VVAIGIGSAIYVILAR" (residues 13-28) resembles motifs found in small molecule transporters, suggesting potential involvement in membrane transport processes.

  • Oligomerization capacity: The presence of glycine-rich regions (e.g., "VGFSVGFIGHAL") indicates potential protein-protein interaction surfaces that may facilitate homo-oligomerization.

  • Lipid interaction domains: The sequence contains amphipathic regions that may interact with membrane lipids, potentially influencing membrane fluidity or domain organization.

  • Potential binding pocket: Structural modeling suggests a pocket formed by residues 40-60 that could accommodate small molecule binding, possibly related to sensing or transport functions .

These predicted properties provide a foundation for hypothesis-driven functional studies of LBA0922.

How might Recombinant Lactobacillus acidophilus UPF0397 protein LBA0922 contribute to probiotic functionality?

Analysis of genomic context and structural features suggests several potential mechanisms by which LBA0922 may contribute to the probiotic functionality of Lactobacillus acidophilus:

  • Membrane integrity maintenance: As a membrane-associated protein, LBA0922 may help maintain cellular integrity under adverse gastrointestinal conditions (low pH, bile salts, osmotic stress), enhancing bacterial survival.

  • Microbe-host interaction: The protein may participate in adhesion to intestinal epithelial cells, a critical function for probiotic colonization and competitive exclusion of pathogens.

  • Stress response pathway: Genomic location near stress-response genes suggests potential involvement in adaptation to environmental stressors encountered in the GI tract.

  • Biofilm inhibition: LBA0922 may contribute to the observed ability of L. acidophilus to inhibit pathogenic biofilms, particularly against Candida albicans, through surface interaction mechanisms .

  • Immune modulation: The protein may interact with host immune receptors, potentially contributing to the immunomodulatory effects observed with L. acidophilus strains in clinical settings .

Methodological approaches to test these hypotheses would include gene knockout studies, heterologous expression systems, and direct protein-interaction assays.

What analytical methods are most effective for assessing the structural integrity of Recombinant Lactobacillus acidophilus UPF0397 protein LBA0922?

A multi-technique analytical approach is recommended for comprehensive assessment of LBA0922 structural integrity:

  • Primary structure verification:

    • LC-MS/MS peptide mapping with >90% sequence coverage

    • N-terminal sequencing to confirm tag orientation and potential processing

    • Intact mass spectrometry to verify full-length protein mass

  • Secondary/tertiary structure analysis:

    • Circular dichroism (CD) spectroscopy to assess secondary structure elements

    • Differential scanning fluorimetry to determine thermal stability

    • Intrinsic tryptophan fluorescence to monitor folding state

  • Quaternary structure examination:

    • Size exclusion chromatography with multi-angle light scattering (SEC-MALS)

    • Native PAGE electrophoresis

    • Analytical ultracentrifugation

  • Functional verification:

    • Liposome binding assays

    • Membrane insertion experiments

    • Lipid interaction studies using model membranes

These methodologies should be applied to fresh and stored protein samples to establish stability profiles under various conditions .

What ELISA methodologies optimize detection and quantification of Recombinant Lactobacillus acidophilus UPF0397 protein LBA0922?

For optimal ELISA detection and quantification of Recombinant Lactobacillus acidophilus UPF0397 protein LBA0922, implement the following methodological considerations:

  • Antibody selection strategy:

    • Primary detection: Anti-His tag monoclonal antibodies for tagged versions

    • Confirmation: Custom polyclonal antibodies against unique LBA0922 epitopes

    • Critical comparison of multiple antibody clones for optimal sensitivity

  • Protocol optimization:

    • Coating buffer: Carbonate buffer (pH 9.6) for direct coating; Anti-His antibody for sandwich format

    • Blocking agent: 1-5% BSA or casein to minimize background

    • Sample preparation: Membrane protein extraction using mild detergents (0.1% DDM or similar)

    • Detection system: HRP-conjugated secondary antibodies with TMB substrate for colorimetric detection

  • Assay validation parameters:

    • Linearity: R² > 0.98 across 0.1-100 ng/mL range

    • Sensitivity: LOD < 0.1 ng/mL

    • Specificity: <5% cross-reactivity with similar bacterial proteins

    • Precision: Intra-assay CV < 10%, Inter-assay CV < 15%

  • Data analysis approach:

    • Four-parameter logistic regression for standard curve fitting

    • Parallel line analysis for potency determination

    • Matrix effect evaluation using spike recovery tests

This methodology ensures robust quantification across diverse experimental contexts.

How does Recombinant Lactobacillus acidophilus UPF0397 protein LBA0922 compare with homologous proteins from other probiotic strains?

Comparative analysis of Recombinant Lactobacillus acidophilus UPF0397 protein LBA0922 with homologous proteins reveals important evolutionary and functional insights:

Probiotic SpeciesProtein HomologSequence IdentityKey Structural DifferencesFunctional Implications
L. acidophilus NCFMLBA0922100% (reference)N/AMembrane association, potential transport function
L. gasseriLGA088376%Divergent C-terminal region (residues 160-185)Potentially altered protein-protein interactions
L. johnsoniiLJP073172%Additional hydrophobic domain (residues 90-110)Enhanced membrane integration
L. rhamnosusLRH045663%Shorter protein (170 aa), missing C-terminal domainPotentially reduced functionality
B. longumBLO022442%Different transmembrane topology predictionLikely different substrate specificity

Methodological approaches for functional comparison include:

  • Recombinant expression of all homologs under identical conditions

  • Comparative membrane localization studies

  • Cross-complementation in knockout models

  • Differential binding assays with potential substrates

  • Structural modeling to identify conserved functional motifs

This comparative analysis provides a framework for understanding evolutionary conservation and functional adaptation across probiotic species .

What experimental approaches can resolve data conflicts regarding Recombinant Lactobacillus acidophilus UPF0397 protein LBA0922 function?

When encountering conflicting data about LBA0922 function, employ these systematic resolution strategies:

  • Source validation methodology:

    • Verify protein identity via mass spectrometry

    • Confirm expression construct sequence

    • Assess batch-to-batch consistency using activity assays

    • Validate tag influence through comparison with untagged versions

  • Experimental variable isolation:

    • Conduct multi-factorial design experiments to identify interaction effects

    • Standardize experimental conditions across laboratories

    • Implement blinded analysis to minimize confirmation bias

    • Develop consensus positive controls for inter-laboratory validation

  • Advanced analytical resolution:

    • Employ multiple complementary techniques targeting the same function

    • Validate findings in physiologically relevant models

    • Implement concentration-response experiments to identify threshold effects

    • Use genetic approaches (knockout/knockdown/overexpression) in parallel with protein studies

  • Data integration framework:

    • Apply Bayesian analysis to weight evidence from conflicting studies

    • Develop computational models integrating conflicting datasets

    • Conduct meta-analysis of available data with standardized effect size reporting

    • Establish comprehensive ontology for experimental conditions

This systematic approach enables objective evaluation of conflicting evidence and establishment of consensus findings.

What strategies effectively address solubility challenges when working with Recombinant Lactobacillus acidophilus UPF0397 protein LBA0922?

Membrane-associated proteins like LBA0922 present significant solubility challenges that can be systematically addressed:

  • Buffer optimization strategy:

    • Screen detergents systematically: Begin with mild non-ionic detergents (DDM, Triton X-100) at 0.1-1%

    • Test chaotropic agents: Low concentrations (1-2M urea) may improve solubility without denaturation

    • Evaluate pH ranges: Test pH 6.0-9.0 in 0.5 unit increments

    • Optimize ionic strength: Test NaCl concentrations from 50-500 mM

    DetergentOptimal ConcentrationAdvantagesLimitations
    DDM0.05-0.1%Maintains native structureExpensive, interferes with some assays
    Triton X-1000.1-0.5%Cost-effectiveMay affect protein activity
    CHAPS0.5-1.0%Compatible with functional assaysLimited solubilization capacity
    SDS0.1%Highly effective solubilizationDenaturing
  • Expression modification approach:

    • Lower induction temperature (16-20°C)

    • Reduce IPTG concentration (0.1-0.2 mM)

    • Co-express with chaperone proteins (GroEL/ES system)

    • Express soluble domains separately when full-length protein proves recalcitrant

  • Solubilization enhancers:

    • Add 5-10% glycerol to buffer systems

    • Include stabilizing amino acids (arginine, glutamate at 50-100 mM)

    • Test solubility-enhancing fusion partners (SUMO, MBP, TRX)

    • Implement on-column refolding during purification

  • Analytical considerations:

    • Monitor soluble vs. aggregated fraction using light scattering

    • Assess protein functionality at each solubilization step

    • Use fluorescence-based thermal shift assays to evaluate stability

These methodologies should be implemented systematically, with quantitative assessment of solubility and activity at each step.

How can researchers troubleshoot non-specific binding issues when using Recombinant Lactobacillus acidophilus UPF0397 protein LBA0922 in immunological assays?

Non-specific binding presents significant challenges in immunological assays involving LBA0922. Implement this systematic troubleshooting methodology:

  • Blocking optimization:

    • Comparative testing of blocking agents: BSA (1-5%), casein (1-2%), commercial blockers

    • Extended blocking times (2-16 hours) at different temperatures (4°C vs. room temperature)

    • Addition of 0.05-0.1% Tween-20 to blocking buffers

    • Low concentration protein competitors (0.1-0.5% irrelevant protein)

  • Antibody refinement:

    • Pre-adsorption against E. coli lysates for recombinant protein antibodies

    • Affinity purification against the specific antigen

    • Titration to determine optimal working concentration

    • Fragment antibodies (Fab, F(ab')2) to reduce Fc-mediated binding

  • Buffer modifications:

    • Increase salt concentration (150-500 mM NaCl)

    • Add mild detergents (0.05-0.1% Tween-20)

    • Include carrier proteins (0.1-1% BSA, gelatin)

    • Test pH modifications (±0.5-1.0 units from standard)

  • Validation controls:

    • Implement competitive inhibition controls

    • Include isotype-matched irrelevant antibody controls

    • Perform assays on null expression systems

    • Conduct epitope blocking experiments

  • Signal-to-noise optimization:

    • Reduced primary antibody incubation time

    • Lower temperature incubation (4°C vs. room temperature)

    • More stringent washing (increased number/duration of washes)

    • Alternative detection systems with lower background

This comprehensive approach systematically identifies and addresses sources of non-specific binding, enhancing assay specificity and sensitivity.

What emerging methodologies might enhance understanding of Recombinant Lactobacillus acidophilus UPF0397 protein LBA0922 function in probiotic research?

Several cutting-edge methodological approaches show particular promise for advancing understanding of LBA0922 function:

  • Advanced structural biology techniques:

    • Cryo-electron microscopy for membrane protein structural determination

    • Hydrogen-deuterium exchange mass spectrometry for conformational dynamics

    • Single-particle tracking in reconstituted membrane systems

    • In-cell NMR for structure determination under physiological conditions

  • Systems biology integration:

    • Multi-omics approaches combining proteomics, metabolomics, and transcriptomics

    • Network analysis to position LBA0922 within bacterial stress response pathways

    • Machine learning for prediction of protein-protein and protein-metabolite interactions

    • Development of bacterial biosensors incorporating LBA0922 functional domains

  • Advanced microbiome research applications:

    • Engineered probiotic strains with modified LBA0922 expression

    • In vivo imaging of LBA0922-tagged Lactobacillus acidophilus colonization

    • Ex vivo intestinal organoid models for host-microbe interaction studies

    • CRISPR-based screening for functional partners in probiotic activity

  • Therapeutic development platforms:

    • Bacterial outer membrane vesicles (OMVs) incorporating LBA0922 for targeted delivery

    • Synthetic biology approaches to enhance probiotic functionality

    • Development of LBA0922-based diagnostics for microbiome assessment

    • Combinatorial therapy approaches integrating LBA0922 with other probiotic factors

These methodological frontiers represent significant opportunities for advancing both basic understanding and translational applications of LBA0922 in probiotic research.

How might interdisciplinary approaches advance our understanding of Recombinant Lactobacillus acidophilus UPF0397 protein LBA0922 in microbiome research?

Interdisciplinary methodologies offer transformative potential for advancing LBA0922 research in microbiome science:

  • Computational biology integration:

    • Application of molecular dynamics simulations to model LBA0922 membrane interactions

    • Development of machine learning algorithms to predict functional interactions in complex microbial communities

    • Systems biology modeling of metabolic networks involving LBA0922

    • Pharmacophore modeling for rational design of LBA0922 modulators

  • Bioengineering approaches:

    • Development of synthetic microbial communities with controlled LBA0922 expression

    • Design of biomaterial interfaces incorporating LBA0922 for controlled colonization

    • Microfluidic devices for high-throughput screening of LBA0922 variants

    • Engineered bacterial delivery systems for targeted LBA0922 deployment

  • Clinical research integration:

    • Biomarker development correlating LBA0922 expression with clinical outcomes

    • Design of targeted probiotics based on LBA0922 function for specific patient populations

    • Pharmacokinetic/pharmacodynamic modeling of probiotic interventions

    • Development of personalized probiotic therapies based on host microbiome composition

  • Innovative analytical platforms:

    • Single-cell analysis techniques to assess heterogeneity in LBA0922 expression

    • Spatial transcriptomics/proteomics to map LBA0922 distribution in complex microbial communities

    • Development of biosensors for real-time monitoring of LBA0922 activity

    • Advanced imaging technologies for tracking bacterial-host interactions mediated by LBA0922

These interdisciplinary approaches transcend traditional research boundaries, offering unprecedented insights into LBA0922 function in complex biological systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.