Recombinant Lactobacillus brevis ATP synthase subunit b (atpF)

What is the structure and organization of ATP synthase subunit b (atpF) in Lactobacillus brevis?

ATP synthase subunit b (atpF) is a component of the F0 sector of F1F0-ATPase in Lactobacillus brevis. The protein consists of 171 amino acids with the sequence: MLSHLVVGQGLYYGDSIFYAVCFLLLMWIIKVLAWKPVTKMMQDRADKISNDIDSAEKSRNDAAELVQKRQAALASSRSEAQTIVNDAKANGQQQREQIVTQAQADVQTLKQNAQKDIEQERQDALSNARNYVADLSIEIASKIIQRELKADDQKALIDSYIEGLGKQHES .

The atpF gene is organized within the ATP operon with the gene order atpBEFHAGDC, which is identical to that observed in other lactic acid bacteria . The b subunit functions as part of the membrane-embedded F0 sector that facilitates proton translocation across the cytoplasmic membrane, contributing to the generation of proton motive force.

How is the ATP synthase operon transcriptionally regulated in L. brevis?

Transcriptional analysis of ATP synthase operons in lactic acid bacteria has revealed complex regulation patterns. In Bifidobacterium species (related to Lactobacillus), the ATP operon is transcribed as two separate mRNAs: a full-length transcript covering all subunits and a shorter transcript corresponding to the last four genes .

The transcription of the ATP operon in lactic acid bacteria is significantly induced under acidic conditions, with maximal induction observed at pH 3.5 . This response is part of the bacterial acid stress adaptation mechanism. In L. brevis, specific transcriptional start sites have been identified upstream of assumed start codons, with putative Pribnow box sequences but without canonical -35 region sequences .

What are the optimal expression and purification protocols for recombinant L. brevis atpF?

For optimal expression of recombinant L. brevis atpF, baculovirus expression systems have proven effective . The protein can be expressed with various tags (determined during manufacturing process) to facilitate purification.

For purification, a general protocol includes:

• Initial centrifugation (2,800 × g for 10 min) to harvest cells

• Cell washing with phosphate buffer (50 mM, pH 7)

• Protein extraction using appropriate lysis methods

• Purification to >85% purity using SDS-PAGE verification

Storage recommendations include:

• Store at -20°C or -80°C for extended storage

• Add 5-50% glycerol (final concentration) when reconstituting

• Maintain working aliquots at 4°C for up to one week

• Avoid repeated freeze-thaw cycles

What methods can be used to study the role of atpF in proton translocation and energy metabolism?

To investigate the role of atpF in proton translocation and energy metabolism, researchers can employ:

• Gene replacement systems: Optimized gene replacement protocols for L. brevis allow for the exchange of wild-type genes with modified constructs .

• Inducible expression systems: Controlled expression using nisin induction (0.8 to 10 ng/ml) allows time-dependent analysis of protein function .

• Transcriptional analysis: RNA extraction followed by Northern blot hybridization and primer extension experiments can reveal ATP operon expression patterns under various conditions .

• Enzymatic activity assays: To measure ATPase activity under different pH conditions to assess functional implications of the protein .

• Membrane potential measurements: To evaluate the protein's role in maintaining proton motive force .

How does L. brevis ATP synthase respond to acid stress conditions?

Lactobacillus brevis demonstrates significant adaptation of ATP synthase function under acid stress conditions. When exposed to acidic environments (pH 4.0), L. brevis shows:

• Increased expression of ATP synthase components, including atpF

• Enhanced ATPase activity to maintain intracellular pH homeostasis

• Modifications in membrane lipid composition to support ATP synthase function

This response is part of a broader acid stress adaptation mechanism that includes:

• The arginine deiminase pathway that contributes to proton motive force generation

• Decreased lactate dehydrogenase expression

• Changes in membrane lipids and cell wall lipoteichoic acids

• Expression of acid-inducible cyclopropane-fatty-acyl-phospholipid synthase

These adaptations collectively enable L. brevis to maintain energy metabolism under acidic conditions that would otherwise be inhibitory to growth.

What is the relationship between ATP synthase activity and hop resistance in L. brevis?

Hop resistance in L. brevis is closely linked to ATP synthase function. Hop compounds (iso-α-acids) act as ionophores that exchange H+ for cellular divalent cations like Mn2+, thereby dissipating ion gradients across the cytoplasmic membrane .

Proteomic analysis of hop-adapted L. brevis strains reveals:

• Adaptation to intracellular acidification through ATP synthase modulation

• Energy conservation mechanisms to maintain ATP production despite ionophore stress

• Regulation of manganese-dependent enzymes, including many hop-regulated enzymes

The ATP synthase complex plays a critical role in this resistance by:

• Contributing to proton motive force maintenance

• Supporting energy generation under stress conditions

• Facilitating pH homeostasis when exposed to hop compounds

These findings demonstrate that hop stress is not only associated with proton motive force depletion but also with divalent cation limitation that affects ATP synthase function.

How does atpF contribute to L. brevis metabolic shifts under varying oxygen conditions?

L. brevis shows remarkable metabolic adaptations to oxygen availability, with ATP synthase subunit b playing a key role in these transitions:

The ATP synthase complex adapts to support these metabolic shifts by maintaining appropriate proton gradients and ATP production levels. Under aerobic conditions, L. brevis ATCC 367 shows conversion of lactate to acetate after glucose exhaustion, with ATP synthase adapting to support this altered energy metabolism pathway .

What is the role of atpF in L. brevis stress responses to phenolic compounds?

In response to phenolic compounds such as ferulic acid, L. brevis demonstrates complex transcriptional responses that include alterations in ATP synthase function:

• Membrane protection: ATP synthase subunit b contributes to counteracting ferulic acid-induced changes in membrane fluidity and ion leakage

• Energy metabolism shifts: Transcriptional profiles reveal upregulation of fumarase (fum), malate dehydrogenase (mdh), and malate permases involved in the citric acid cycle, with implications for ATP synthase function

• Fatty acid synthesis: β-ketoacyl-(acyl-carrier-protein) reductase (fabG, LVIS-0378) is upregulated, suggesting altered membrane lipid abundance as a defense mechanism against ferulic acid-induced membrane fluidity changes, which directly affects ATP synthase function

These adaptations allow L. brevis to maintain energy metabolism and membrane integrity under conditions that would otherwise be inhibitory.

How can structural studies of L. brevis atpF inform our understanding of bacterial ATP synthases?

Structural studies of L. brevis ATP synthase subunit b can provide valuable insights into bacterial ATP synthase function by:

• Revealing the architecture of the membrane region and how simple bacterial ATP synthases perform the same core functions as more complex mitochondrial complexes

• Elucidating the path of transmembrane proton translocation, which is critical for understanding energy conversion mechanisms

• Providing a model for interpreting biochemical analyses of specific residues' roles in enzyme function

Recent cryo-EM studies of bacterial ATP synthases have shown how the complex adopts different rotational states, with the position of various subunits revealing how ATP synthesis is allowed while ATP hydrolysis is inhibited . Similar approaches with L. brevis ATP synthase could reveal species-specific adaptations that contribute to this bacterium's unique stress tolerance capabilities.

How does L. brevis ATP synthase interact with host immune cells?

L. brevis components, including surface proteins like S-layer, have been shown to interact with host immune receptors such as Mincle (Macrophage-inducible C-type lectin), impacting antigen-presenting cell functions :

• Cytokine modulation: L. brevis interactions lead to balanced cytokine responses in bone marrow-derived cells by triggering both pro- and anti-inflammatory cytokines

• Signaling pathways: Interactions occur through the Mincle/Syk/Card9 axis, which appears to be a key factor in host-microbiota interactions

• Immunomodulatory effects: L. brevis can reduce the expression of inflammation biomarkers like TLR-4 and IL-6, even after LPS challenge

While these studies have focused primarily on S-layer proteins, ATP synthase components may also play roles in these interactions, either directly or by supporting bacterial adaptation to the host environment.

What methodologies are appropriate for investigating potential cross-reactivity between bacterial ATP synthase subunits and host immune targets?

To investigate potential cross-reactivity between L. brevis atpF and host immune targets, researchers can employ:

• Flow cytometric binding assays: Using Ca2+-dependent binding assays similar to those employed for S-layer protein studies

• ELISA-based binding assays: To detect interactions between purified atpF and host immune receptors

• HEK cell reporter systems: Using cells expressing specific immune receptors (like HEK-Blue™ reporter cells) to detect activation upon exposure to bacterial proteins

• qRT-PCR analysis: To measure changes in immune marker expression in cell lines exposed to bacterial components

• Western blotting: To evaluate activation of specific signaling pathways (e.g., NF-κB) in protein extracts from treated cells

These methods can help determine whether ATP synthase components contribute to the immunomodulatory properties observed with L. brevis.