Recombinant Lactobacillus brevis Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Description

Introduction

The Lactobacillus brevis Large-Conductance Mechanosensitive Channel (MscL) is a protein channel found in the bacterium Lactobacillus brevis. MscL channels are known for their role in allowing cells to respond to mechanical stresses . The MscL from L. brevis can be produced using recombinant DNA technology, where the gene encoding the channel is inserted into a host organism (e.g., E. coli) for protein production .

Lactobacillus brevis and its S-Layer

Lactobacillus brevis is a lactic acid bacterium (LAB) recognized for probiotic properties, making it useful as a dietary supplement and vaccine vector .

A notable feature of L. brevis is its Surface layer (S-layer), composed of protein subunits (SlpA) . S-layers can be used for the surface display of foreign antigenic epitopes. Using an inducible expression system, scientists can produce L. brevis strains with chimeric S-layers by inserting foreign epitopes into the slpA gene .

Mechanosensitive Channels (MscL)

Mechanosensitive channels, like MscL, are integral membrane proteins that respond to mechanical stimuli such as stretching or changes in pressure. These channels act as emergency release valves, opening pores in the cell membrane to relieve excess tension and prevent cell lysis .

Recombinant Production of L. brevis MscL

Recombinant DNA technology facilitates the production of L. brevis MscL in host organisms like E. coli . This involves cloning the mscL gene from L. brevis into a plasmid vector and introducing it into E. coli cells. The E. coli then transcribes and translates the gene, producing the L. brevis MscL protein. Recombinant production allows for large quantities of the protein to be made for research and industrial applications .

Applications of Recombinant L. brevis MscL

  1. Structural and Functional Studies: Recombinant MscL allows researchers to investigate the channel's structure and gating mechanisms. These studies enhance the understanding of mechanotransduction in bacteria and other organisms.

  2. Biotechnology: Engineered MscL channels can be used in biotechnological applications, such as biosensors and drug delivery systems.

  3. Vaccine Development: Lactobacillus species can be used as live mucosal antigen delivery vehicles. Surface display of antigens on the S-layer of L. brevis has been explored for vaccine development .

Mincle receptor and S-Layer

The S-layer of L. brevis interacts with the macrophage-inducible C-type lectin (Mincle), which is a receptor involved in immune responses . This interaction is calcium-dependent and can modulate the production of cytokines .

Examples of research findings

  • S-layer from L. brevis modulates antigen-presenting cells .

  • Engineered Lactobacillus strains can display foreign proteins on their surface, which can help with maintaining intestinal health .

  • S-layer subunits of L. brevis can be utilized for the surface display of foreign antigenic epitopes .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please specify it in your order; we will prioritize its inclusion.
Synonyms
mscL; LVIS_0723; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-127
Protein Length
full length protein
Species
Lactobacillus brevis (strain ATCC 367 / JCM 1170)
Target Names
mscL
Target Protein Sequence
MLKEFKEFIARGNVMDLAVGVIVGAAFTAIVNSLVTNIINPLLGIFVGSIDFSNLVFTVG SAHFRYGAFINSVINFLIIAFVVFLLIKLINKLIAKPAEEPEEAVPSQEEKYLQEIVELL KQDKIEH
Uniprot No.

Target Background

Function

A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a regulatory role in cellular osmotic pressure changes.

Database Links
Protein Families
MscL family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Large-conductance mechanosensitive channel (mscL) in Lactobacillus brevis?

The Large-conductance mechanosensitive channel (mscL) in Lactobacillus brevis is a membrane protein channel that responds to mechanical tension in the bacterial cell membrane. These channels act as emergency release valves during osmotic downshock, preventing cell lysis by allowing rapid efflux of cytoplasmic solutes when bacteria transition from high to low osmolarity environments. In L. brevis, mscL likely plays a crucial role in maintaining cellular homeostasis, particularly important given this organism's probiotic properties and ability to survive gastrointestinal transit where osmotic conditions vary dramatically.

How does the genetic structure of mscL in L. brevis compare to other bacterial species?

The mscL gene in L. brevis shares homology with other bacterial mscL genes but contains specific sequence variations reflecting its adaptation to the ecological niche of this lactic acid bacterium. While the core functional domains are conserved across bacterial species, L. brevis mscL likely contains unique amino acid substitutions that may influence its gating threshold, conductance properties, and interaction with the specific membrane composition of L. brevis. Comparative genomic analysis would typically reveal conservation in transmembrane domains while showing greater variation in cytoplasmic regions.

What role might mscL play in L. brevis stress responses beyond osmotic regulation?

Beyond osmotic regulation, mscL in L. brevis likely contributes to multiple stress responses including:

  • Acid tolerance: Critical for survival in both fermentation environments and gastrointestinal transit

  • Temperature fluctuation adaptation: Particularly relevant in food fermentation applications

  • Membrane integrity maintenance during exposure to bile salts: Essential for probiotic functionality

This multi-functional role makes mscL potentially significant in the stress response mechanisms that enable L. brevis to function effectively as a probiotic organism, similar to how other surface proteins in L. brevis contribute to its survival in harsh environments .

What are the optimal expression systems for recombinant L. brevis mscL production?

For recombinant expression of L. brevis mscL, researchers should consider the following systems:

Expression SystemAdvantagesLimitationsRecommended Applications
E. coli (BL21)High yield, well-established protocolsMay form inclusion bodiesInitial structural studies
L. lactisNative-like membrane environmentLower yieldFunctional studies
Cell-free systemsAvoids toxicity issuesCostly, limited scaleRapid screening, difficult-to-express variants
Bacillus subtilisEfficient secretionDifferent membrane compositionLarge-scale production

The optimal approach typically involves initial characterization in E. coli systems followed by validation in more native-like expression hosts. When expressing in heterologous systems, codon optimization may be necessary to account for the different codon usage bias compared to L. brevis genomic DNA.

How can researchers overcome common expression challenges with recombinant L. brevis mscL?

Membrane protein expression challenges for L. brevis mscL can be addressed through several strategies:

  • Fusion partners: Adding soluble partners like thioredoxin or SUMO can improve folding

  • Controlled expression: Using tightly regulated promoters prevents toxic accumulation

  • Modified growth conditions: Lower temperatures (16-20°C) often improve proper folding

  • Membrane-mimetic environments: Detergents (DDM, LDAO) or nanodiscs for extraction and stabilization

  • Signal sequence optimization: Especially important for proper membrane targeting

Researchers should implement cell viability monitoring throughout expression as overexpression of membrane channels can compromise host cell integrity.

What electrophysiological approaches are most suitable for characterizing L. brevis mscL?

For electrophysiological characterization of recombinant L. brevis mscL:

  • Patch-clamp techniques:

    • Reconstitution in liposomes or giant spheroplasts

    • Cell-attached or excised patch configurations

    • Pressure application systems for controlled mechanical stimulation

  • Planar lipid bilayer recordings:

    • Allowing precise control of membrane composition

    • Enabling study of isolated channel behavior

  • Fluorescence-based assays:

    • Calcein release from liposomes under osmotic stress

    • Voltage-sensitive dyes to monitor membrane potential changes

When designing these experiments, researchers should consider the native lipid environment of L. brevis membranes, as lipid composition can significantly affect mscL gating properties.

How can researchers assess the functionality of recombinant L. brevis mscL in vivo?

Functional assessment of recombinant L. brevis mscL can be performed through:

  • Osmotic downshock survival assays:

    • Compare survival rates between wild-type and mscL-deletion strains

    • Complement deletion strains with recombinant mscL variants

    • Quantify survival under increasing hypoosmotic stress levels

  • Solute release measurements:

    • Monitor efflux of pre-loaded fluorescent markers during osmotic downshock

    • Measure small molecule (amino acids, ions) release under controlled conditions

  • Growth phenotype analysis:

    • Assess growth curves under fluctuating osmotic conditions

    • Compare lag phase duration after osmotic shifts

These methods should be combined with proper controls including non-functional mscL mutants to validate that observed effects are specifically related to mscL activity.

What are the current methods for structural determination of L. brevis mscL?

The structural characterization of recombinant L. brevis mscL can be approached through:

  • X-ray crystallography:

    • Requires high-purity protein and suitable crystallization conditions

    • Typically employs detergent-solubilized protein or lipidic cubic phase techniques

    • Challenges include obtaining well-diffracting crystals

  • Cryo-electron microscopy:

    • Single-particle analysis for high-resolution structure

    • Can capture different conformational states

    • Particularly valuable for membrane proteins resistant to crystallization

  • Nuclear Magnetic Resonance (NMR):

    • Solution-state NMR for dynamic regions

    • Solid-state NMR for membrane-embedded portions

    • Provides information on molecular dynamics

  • Molecular dynamics simulations:

    • Complementary to experimental methods

    • Predicts channel behavior under mechanical tension

    • Models conformational changes during gating

Each method provides complementary information, with researchers often employing multiple approaches for comprehensive structural characterization.

How might the immunomodulatory properties of L. brevis affect mscL-related research?

When studying recombinant L. brevis mscL, researchers should consider potential immunomodulatory complications:

  • S-layer protein interactions: L. brevis S-layer engages the Mincle receptor on immune cells, triggering a balanced cytokine response . This interaction could potentially:

    • Mask mscL-specific effects in immunological experiments

    • Confound host response studies if mscL and S-layer proteins co-purify

    • Require careful experimental design to distinguish mscL-specific vs. S-layer-mediated effects

  • Cytokine modulation: L. brevis stimulation triggers both pro-inflammatory (TNF, IL-6) and anti-inflammatory (IL-10, TGF-β) cytokines in a Mincle/Syk/CARD9-dependent manner . Researchers should:

    • Account for this background immunomodulatory activity

    • Consider how membrane stress (which activates mscL) might alter S-layer presentation

    • Implement appropriate controls when studying immune responses to recombinant mscL

  • Experimental considerations:

    • Use purified recombinant mscL free from other L. brevis components

    • Compare wild-type vs. mscL-knockout strains in immunological assays

    • Consider how membrane disruption during osmotic stress might release immunomodulatory components

Could mscL function contribute to the probiotic properties of L. brevis?

The potential relationship between mscL function and L. brevis probiotic properties warrants investigation:

  • Gastrointestinal survival: mscL may contribute to L. brevis survival during transit through varying osmotic environments of the GI tract, similar to how L. brevis strains demonstrate resistance to simulated intestinal juice at various pH levels .

  • Stress resistance connection: mscL-mediated osmoadaptation might work synergistically with other stress responses (acid tolerance, bile resistance) that contribute to probiotic efficacy.

  • Therapeutic implications: L. brevis shows therapeutic effects in conditions like hepatocellular carcinoma in the context of Type 2 diabetes . The contribution of membrane homeostasis through mscL to these effects represents an interesting research direction.

  • Research approach: Investigators could examine how mscL mutations affect the probiotic properties of L. brevis, including:

    • Colonization efficiency

    • Stress survival in gastrointestinal conditions

    • Interaction with host epithelial cells

    • Maintenance of beneficial metabolic activities (e.g., GABA production )

What site-directed mutagenesis approaches are most informative for L. brevis mscL functional studies?

Strategic mutagenesis of L. brevis mscL can provide valuable insights into channel function:

  • Key residues for targeted mutagenesis:

    • Pore-lining residues: Altering hydrophobicity affects gating threshold

    • Transmembrane domain interfaces: Impacts channel stability and conformational changes

    • Cytoplasmic regions: May influence interaction with other cellular components

  • Mutagenesis approaches:

    • Alanine scanning: Systematic replacement to identify critical residues

    • Conservative substitutions: Preserving chemical properties while introducing subtle changes

    • Cysteine scanning: For subsequent labeling with fluorescent or spin probes

    • Charge substitutions: To investigate electrostatic interactions during gating

  • Functional validation of mutants:

    • Patch-clamp analysis of tension sensitivity and conductance

    • In vivo growth phenotypes under oscillating osmotic conditions

    • Protein-protein interaction changes using crosslinking or co-immunoprecipitation

What are the most effective purification strategies for recombinant L. brevis mscL?

Optimized purification of recombinant L. brevis mscL requires attention to membrane protein-specific challenges:

  • Solubilization optimization:

    • Detergent screening: DDM, LDAO, LMNG for initial extraction

    • Detergent concentration gradient testing: Balancing extraction efficiency vs. protein stability

    • Lipid supplementation: Including native-like lipids to maintain functionality

  • Purification workflow:

    StepMethodCritical Considerations
    Affinity purificationIMAC (His-tag)Imidazole concentration optimization to minimize non-specific binding
    Ion exchangeAnion/cation exchangeBuffer pH selection based on L. brevis mscL theoretical pI
    Size exclusionGel filtrationAssessing oligomeric state and homogeneity
    Functional verificationReconstitution assaysConfirming channel activity after purification
  • Quality control assessments:

    • SDS-PAGE and Western blotting for purity and identity

    • Circular dichroism to verify secondary structure integrity

    • Dynamic light scattering for homogeneity

    • Mass spectrometry for accurate molecular weight and post-translational modifications

How can recombinant L. brevis mscL be utilized in biosensor development?

Recombinant L. brevis mscL offers potential for biosensor applications through these approaches:

  • Tension-sensitive biosensors:

    • Engineering fluorescent protein fusions to detect conformational changes

    • Developing FRET-based sensors using strategically placed fluorophores

    • Creating electrical biosensors for sensitive tension detection

  • Potential applications:

    • Monitoring osmotic stress in fermentation processes

    • High-throughput screening of compounds affecting membrane properties

    • Environmental monitoring of osmotic stressors

    • Biophysical research tools for membrane mechanics studies

  • Experimental design considerations:

    • Optimize linker regions between mscL and reporter domains

    • Validate that modifications preserve native channel function

    • Balance sensitivity with signal-to-noise ratio

    • Consider the impact of expression system on sensor performance

What emerging techniques might advance our understanding of L. brevis mscL in the context of its probiotic functions?

Cutting-edge approaches to understand the relationship between L. brevis mscL and probiotic functionality include:

  • Single-cell techniques:

    • Microfluidic osmotic challenge platforms

    • Single-cell RNA-seq to capture transcriptional responses

    • High-resolution imaging of membrane dynamics during osmotic stress

  • Multi-omics integration:

    • Combining transcriptomics, proteomics, and metabolomics data

    • Systems biology approaches to model mscL's role in L. brevis stress response networks

    • Correlating mscL activity with broader probiotic functions

  • Host-microbe interaction studies:

    • Co-culture systems with intestinal epithelial cells

    • Organoid models to study L. brevis colonization and interaction

    • In vivo imaging of fluorescently-labeled L. brevis strains (wild-type vs. mscL mutants)

  • CRISPR-based approaches:

    • Precise genome editing in L. brevis to create clean mscL knockouts

    • CRISPRi for conditional mscL repression

    • Base editing for subtle modifications to channel properties

These emerging techniques could connect L. brevis mscL function to the organism's demonstrated therapeutic effects in conditions like Type 2 diabetes and hepatocellular carcinoma .

What are the key unresolved questions regarding L. brevis mscL?

Critical knowledge gaps in our understanding of L. brevis mscL include:

  • Structural determinants:

    • High-resolution structure in different conformational states

    • Lipid-protein interactions specific to L. brevis membrane composition

    • Comparison with other bacterial mscL structures

  • Physiological role:

    • Contribution to probiotic properties and stress adaptation

    • Interaction with other membrane proteins and cellular machinery

    • Role in environmental persistence and host colonization

  • Biotechnological applications:

    • Potential as a drug delivery system through controlled gating

    • Applications in synthetic biology and designed cellular responses

    • Integration into advanced biosensing platforms

Addressing these questions will advance both basic understanding of bacterial mechanosensation and potential applications of L. brevis as a probiotic and biotechnological tool.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.