Recombinant Lactobacillus casei Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Lactobacillus casei Large-conductance Mechanosensitive Channel (mscL)

The Recombinant Lactobacillus casei Large-conductance mechanosensitive channel (mscL) is a recombinant protein derived from the bacterium Lactobacillus casei. This protein is part of a larger family of mechanosensitive channels, which are crucial for maintaining cellular osmotic balance by allowing ions to flow out of the cell in response to mechanical stress, such as changes in pressure or volume. The mscL channel is particularly noted for its large conductance, making it one of the most efficient ion channels in bacteria.

Structure and Function of mscL

The mscL channel is a pentameric structure composed of five identical subunits. Each subunit consists of two transmembrane helices and a cytoplasmic helix. The channel's large conductance is due to its wide pore diameter, which allows it to pass large ions and even small molecules. The mscL channel is activated by membrane tension, which is generated by changes in osmotic pressure. This activation leads to the opening of the channel, allowing ions to flow out of the cell and helping to maintain cellular integrity.

Recombinant Expression in Lactobacillus casei

Recombinant expression of the mscL channel in Lactobacillus casei involves the use of genetic engineering techniques to introduce the gene encoding the mscL protein into the bacterial genome. This allows for the production of large quantities of the protein for research and potential therapeutic applications. Lactobacillus casei is chosen for its safety profile and ability to survive in various environments, making it a suitable host for recombinant protein production.

Applications and Research Findings

While specific research on the Recombinant Lactobacillus casei Large-conductance mechanosensitive channel (mscL) is limited, mechanosensitive channels like mscL have been studied extensively for their role in bacterial physiology and potential applications in biotechnology. For instance, understanding how these channels function can provide insights into developing new strategies for bacterial cell engineering and improving bacterial survival under stress conditions.

Table: Characteristics of Recombinant Lactobacillus casei mscL

CharacteristicsDescription
Protein TypeLarge-conductance mechanosensitive channel
Host OrganismLactobacillus casei
FunctionMaintains osmotic balance by allowing ion flow in response to mechanical stress
StructurePentameric structure with two transmembrane helices and a cytoplasmic helix per subunit
ConductanceLarge, allowing passage of large ions and small molecules
ActivationActivated by membrane tension due to osmotic changes

References

  1. ELISA Recombinant Lactobacillus casei Large-conductance mechanosensitive channel(mscL) -

  2. General Information on Mechanosensitive Channels - Various scientific literature on bacterial mechanosensitive channels.

  3. Lactobacillus casei as a Host for Recombinant Protein Production -

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
mscL; LCABL_27460; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-123
Protein Length
full length protein
Species
Lactobacillus casei (strain BL23)
Target Names
mscL
Target Protein Sequence
MLKEFQKFIMRGNVLDLAVGVIIGSAFTGLVTSLTKNLINPILSMFAGKADLSGLYFTIL GAKFTYGNFINDVLNFLIIAFVVFLLVKGINRILPSKPAKPAGPTQEELLTEIRDLLKQD QQV
Uniprot No.

Target Background

Function
A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a role in regulating intracellular osmotic pressure changes.
Database Links
Protein Families
MscL family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage conditions for maintaining recombinant L. casei mscL stability and activity?

For optimal stability of recombinant L. casei mscL protein, the following storage guidelines should be implemented:

  • The lyophilized protein powder should be stored at -20°C/-80°C upon receipt.

  • Working aliquots can be stored at 4°C for up to one week.

  • For reconstitution, use deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL.

  • Add glycerol to a final concentration of 5-50% (default recommendation is 50%) before aliquoting for long-term storage at -20°C/-80°C.

  • Avoid repeated freeze-thaw cycles as this significantly reduces protein stability .

The protein is typically supplied in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0, which helps maintain structural integrity during lyophilization and reconstitution .

How can researchers verify the purity and functionality of recombinant L. casei mscL protein preparations?

Verification of recombinant L. casei mscL protein quality requires multiple analytical approaches:

  • Purity assessment: SDS-PAGE analysis should demonstrate >90% purity, focusing on the expected molecular weight of approximately 13.5 kDa plus the His-tag contribution .

  • Structural integrity: Circular dichroism spectroscopy can confirm proper secondary structure formation, particularly the alpha-helical content characteristic of transmembrane domains.

  • Functional validation: Patch-clamp electrophysiology using reconstituted protein in liposomes can verify mechanosensitive gating properties. Channel activity should be observed in response to membrane tension, with MscS serving as an internal standard for comparative mechanosensitivity assessment .

  • Membrane integration: Fluorescence microscopy with labeled protein can confirm proper membrane localization when expressed in bacterial systems.

How do structural dynamics influence the gating mechanism of L. casei mscL channels?

The gating mechanism of L. casei mscL involves complex structural rearrangements that can be investigated through multiple experimental and computational approaches. Studies combining coarse-grained simulations with experimental restraints from EPR and FRET have provided significant insights into this process:

The apparent contradictions between different experimental findings on MscL gating mechanisms highlight the complexity of this process and the importance of integrating multiple experimental approaches .

What role do electrostatic interactions play in L. casei mscL channel mechanosensitivity?

Electrostatic interactions at the membrane interface critically define MscL channel mechanosensitivity. Research has revealed:

  • Chimeric analysis approach: Studies using chimeras containing a small subset of residues (aa 98-106, according to the E. coli MscL registry) at the end of TM2 demonstrate that even minor sequence variations can significantly alter mechanosensitivity .

  • Mechanosensitivity quantification: The pL/pS ratio, where MscS serves as an internal standard within the patch, provides a standardized measurement of mechanosensitivity. Lower numbers indicate gating at lower tensions, thus higher mechanosensitivity .

  • Contradictory findings resolution: Despite apparent contradictions in some studies regarding electrostatic effects, careful analysis demonstrates that electrostatic interactions unambiguously affect channel mechanosensitivity. These interactions are particularly important at the membrane-cytoplasm interface and between adjacent subunits .

  • Methodological considerations:

    • Patch-clamp experiments must account for differences in patch geometry using Laplace's law (tension depends on both pressure and radius of curvature)

    • Standardization using MscS is essential for comparing results across different experimental conditions

How can recombinant L. casei mscL be utilized in vaccine development and delivery systems?

The application of recombinant Lactobacillus systems for vaccine development represents an advanced research area with significant potential. While specific data on L. casei mscL as a vaccine component is limited, research on other recombinant Lactobacillus systems provides valuable insights:

  • Oral vaccination advantages: Lactobacilli are considered safe organisms, making them attractive vehicles for oral vaccination. L. johnsonii has been shown to partially survive simulated gastric conditions in vitro, suggesting similar potential for L. casei .

  • Vector system considerations: Using appropriate vector systems, researchers can express both individual proteins and fusion proteins on the surface of Lactobacillus. For example, proteinase PrtB and a tetanus toxin mimotope-PrtB fusion protein have been successfully expressed on L. johnsonii surface .

  • Immune response induction: Recombinant Lactobacillus expressing surface proteins can induce both systemic IgG responses and local mucosal IgA responses, as demonstrated with PrtB-expressing L. johnsonii .

  • Advanced applications: Recent studies with recombinant L. casei have demonstrated promising results in developing vaccines against viral pathogens. For example, a recombinant L. casei expression system (pPG-612-CK6-G/L. casei 393) was constructed using a truncated IHNV G gene with rainbow trout chemokine CK6 gene, showing significant immunoprotective effects .

Recombinant SystemVectorTarget AntigenImmune ResponseReference
L. johnsoniiNew vector systemProteinase PrtBSystemic IgG and fecal IgA
L. johnsoniiNew vector systemTTmim-PrtB fusionIgG against L. johnsonii and PrtB
L. casei 393pPG-612CK6-G (IHNV)Protective immunity

What computational approaches are most effective for studying L. casei mscL structural dynamics?

Researchers investigating L. casei mscL structural dynamics should consider a multi-faceted computational approach:

  • Coarse-grained molecular dynamics: The MARTINI force field provides an effective balance between computational efficiency and structural accuracy. This approach represents approximately four heavy atoms as a single coarse-grained particle, enabling simulations in the microsecond range .

  • Integration of experimental restraints: Incorporating inter-subunit distances from FRET experiments and solvent accessibility data from EPR studies as restraints in simulations produces more physiologically relevant models than unrestrained simulations .

  • Strategic sampling approach: Rather than running a single long simulation, researchers should conduct multiple simulations with different combinations of restraints and membrane tensions to test the sensitivity of the final structure to specific parameters .

  • Tension parameters: Apply membrane tensions of 12 dynes/cm (physiological tension required to induce gating in patch clamp experiments) and/or 30 dynes/cm (typically needed in simulations to induce gating within feasible timeframes) .

  • Analysis considerations:

    • Focus on stable conformations rather than transient intermediates

    • Compare pore diameter profiles across different simulations

    • Analyze water permeation as an indicator of channel opening

    • Validate structural models against experimental distance measurements

It's important to note that while these simulations provide valuable structural insights, they should not be used to study intermediate structures or analyze the precise sequence of structural changes during gating without additional validation .

How can researchers effectively express and purify recombinant L. casei mscL for structural and functional studies?

Successful expression and purification of recombinant L. casei mscL requires careful optimization of multiple parameters:

  • Expression system selection: E. coli is the preferred expression system for L. casei mscL, providing high yields while maintaining protein functionality . The specific strain should be optimized based on codon usage analysis.

  • Vector design considerations:

    • Include an N-terminal His-tag for efficient purification

    • Ensure the full-length sequence (amino acids 1-123) is included

    • Consider using inducible promoters (e.g., T7) to control expression levels

  • Purification protocol optimization:

    • Solubilize membrane fractions using appropriate detergents (typically DDM or LDAO)

    • Perform immobilized metal affinity chromatography (IMAC) for initial purification

    • Consider size exclusion chromatography as a polishing step

    • Verify purity using SDS-PAGE (>90% purity is required for most applications)

  • Reconstitution for functional studies:

    • For electrophysiology studies, reconstitute purified protein into liposomes

    • For structural studies, consider detergent screening to identify conditions that maintain native structure

  • Quality control checkpoints:

    • Verify protein identity using mass spectrometry

    • Confirm secondary structure using circular dichroism

    • Assess oligomeric state using native PAGE or analytical ultracentrifugation

What experimental approaches can resolve contradictory findings in L. casei mscL research?

Resolving contradictory findings in L. casei mscL research requires rigorous methodological approaches:

  • Standardized mechanosensitivity measurements: Use the pL/pS ratio where MscS serves as an internal standard to normalize for variations in patch geometry and membrane properties across different experiments .

  • Integrative structural biology approach: Combine multiple structural techniques including:

    • X-ray crystallography for high-resolution static structures

    • Cryo-EM for capturing different conformational states

    • FRET and EPR for dynamic distance measurements

    • Computational modeling to integrate diverse experimental constraints

  • Systematic mutagenesis studies: Create chimeric constructs to isolate specific regions responsible for functional differences, as demonstrated with chimeras containing residues 98-106 that showed significantly different mechanosensitivity .

  • Controlled experimental conditions:

    • Precisely control membrane composition when studying mechanosensitivity

    • Account for differences in patch geometry using Laplace's law

    • Carefully control protein expression levels in cellular systems

  • Simulation validation: When using computational approaches to resolve contradictions, validate models against multiple experimental datasets and consider performing simulations with different starting conditions and parameter sets to assess robustness .

The apparent contradictions in MscL research often stem from differences in experimental conditions or interpretations rather than fundamental biological inconsistencies. By employing these methodological approaches, researchers can develop more comprehensive models that reconcile seemingly contradictory findings.

What emerging technologies could advance our understanding of L. casei mscL structure and function?

Several cutting-edge technologies show promise for advancing L. casei mscL research:

  • Single-molecule FRET (smFRET): This technique can provide direct visualization of conformational dynamics in individual MscL channels, revealing heterogeneity and rare states that might be missed in ensemble measurements.

  • In-cell NMR spectroscopy: Applying this emerging technique to study MscL dynamics within intact bacterial cells could provide insights into how cellular factors influence channel function.

  • Advanced computational approaches: Machine learning-enhanced molecular dynamics simulations could significantly improve sampling efficiency and enable longer timescale simulations to capture the complete gating process.

  • Cryo-electron tomography: This technique could visualize MscL channels in their native membrane environment, providing structural insights complementary to traditional structural biology approaches.

  • Optogenetic control of membrane tension: Developing light-responsive membrane components could enable precise spatiotemporal control of membrane tension for studying MscL gating kinetics.

How might L. casei mscL be engineered for novel biotechnological applications?

The unique properties of L. casei mscL present several opportunities for biotechnological innovations:

  • Engineered biosensors: Modified MscL channels could serve as molecular sensors for membrane tension in various biological systems, with potential applications in drug screening and mechanobiology research.

  • Advanced vaccine delivery systems: Building on existing research with recombinant Lactobacillus , L. casei mscL could be engineered as part of fusion proteins for targeted antigen delivery to mucosal immune systems.

  • Controlled release systems: MscL channels could be engineered with modified gating properties to create tension-responsive release systems for therapeutic compounds.

  • Synthetic cellular mechanotransduction: Engineered MscL variants could enable synthetic biology applications where cellular responses are coupled to mechanical stimuli through customized mechanosensitive channels.

  • Biophysical research tools: Well-characterized L. casei mscL variants could serve as model systems for studying fundamental aspects of membrane protein folding, stability, and dynamics.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.