Recombinant Lactobacillus casei Thiamine transporter ThiT (thiT)

Shipped with Ice Packs
In Stock

Description

Introduction and Biological Role

The thiamine transporter ThiT (thiT) is a membrane-associated protein in Lactobacillus casei responsible for the active uptake of thiamine (vitamin B₁). It operates as part of an Energy Coupling Factor (ECF) transport system, which couples substrate uptake to ATP hydrolysis . ThiT exhibits high substrate specificity, enabling L. casei to accumulate thiamine against concentration gradients, even in thiamine-scarce environments . This transporter is critical for bacterial survival, as thiamine is essential for coenzyme synthesis (e.g., thiamine pyrophosphate) in energy metabolism .

Transport Mechanism and Binding Dynamics

ThiT facilitates thiamine uptake through a two-step process:

  1. Substrate recognition: High-affinity binding via hydrogen bonds and hydrophobic interactions between thiamine and ThiT’s soluble domain .

  2. Transport coupling: Interaction with the EcfAA′T module enables ATP-driven translocation across the membrane .

Key Findings:

  • Energy dependence: Transport requires ATP and is inhibited by substrate analogs (e.g., oxythiamine) .

  • Competition: ThiT dynamically associates with the EcfAA′T module, competing with other S-components (e.g., folate transporters) .

Recombinant Production and Expression Systems

Recombinant ThiT is primarily produced in E. coli or L. lactis for structural and functional studies.

Table 2: Recombinant ThiT Production Systems

Host OrganismExpression VectorPurification TagYield/QualitySource
E. colipET-derivedN-terminal His-tagHigh
L. lactisPlasmid-basedNativeModerate

Challenges:

  • Membrane protein solubility: ThiT’s hydrophobic regions require detergent solubilization during purification .

  • Functional validation: Recombinant ThiT retains thiamine-binding activity but requires co-expression with EcfAA′T for transport function in heterologous systems .

Biotechnological Applications

ThiT’s unique properties position it for applications in:

  • Probiotic engineering: Enhancing thiamine uptake in L. casei strains for improved vitamin bioavailability .

  • Biosensors: Leveraging its high-affinity binding for detecting thiamine levels in food or biological samples .

Product Specs

Form
Lyophilized powder
Note: While we strive to ship the format we have in stock, we are happy to accommodate any special requirements you may have. Please specify your preferred format in your order notes.
Lead Time
Delivery time may vary depending on your location and the purchase method. Please consult your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the protein at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life of our proteins is influenced by various factors such as storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize your preference in our development process.
Synonyms
thiT; LSEI_1757; Thiamine transporter ThiT; Thiamine ECF transporter S component ThiT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-201
Protein Length
full length protein
Species
Lactobacillus paracasei (strain ATCC 334 / BCRC 17002 / CIP 107868 / KCTC 3260 / NRRL B-441)
Target Names
thiT
Target Protein Sequence
MQQHKQLVVILETAIIAAFAMALTYIPHTTGVSAIELNYGLIPIAVLAMRRGLVPAAWAG FVWGILDLILRGIGGGSVLNPLQGILEYPIAFTLVGLMGLTFASFQKAVRGSEKVKASGY AFAGIIIGTFAKYFIHFIAGVVFWGAYAPKGTNVWVYSLIVNGGSALFSTVLTIVVVGVL LTVAPQLFVAKDGKSFSTKAA
Uniprot No.

Target Background

Function
Thiamine-binding protein that interacts with the energy-coupling factor (ECF) ABC-transporter complex. Unlike traditional ABC transporters, this ECF transporter provides the energy required for the transport of various substrates. These substrates bind to transmembrane proteins, not extracytoplasmic soluble proteins, and are transported into cells. Thiamine binds with a dissociation constant of 0.5 nM. When co-expressed with its energy-coupling factor (ECF) ABC-transporter complex EcfA1A2T in Lactococcus lactis subsp. cremoris (strain NZ9000), it enables thiamine uptake. This uptake process necessitates both ThiT and EcfA1A2T.
Database Links
Protein Families
Vitamin uptake transporter (VUT/ECF) (TC 2.A.88) family, Thiamine transporter subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the ThiT transporter and what role does it play in Lactobacillus casei?

ThiT is an S-component involved in thiamine (vitamin B1) transport in Lactobacillus casei and related lactic acid bacteria. It functions as part of an Energy Coupling Factor (ECF) transporter system, which belongs to the ATP-binding cassette (ABC) transporter superfamily. In L. casei, thiamine transport proceeds via a system with properties typical of active uptake processes: it requires energy, exhibits temperature dependence, demonstrates saturation kinetics, and can be inhibited by substrate analogs . ThiT serves as the high-affinity substrate-binding component of this system, residing in the cell membrane and enabling the bacterium to efficiently capture thiamine from the environment .

What is the binding affinity of ThiT for thiamine and how does this compare to other transporters?

ThiT demonstrates exceptionally high affinity for thiamine, with a dissociation constant (Kd) of approximately 120 pM as determined in studies with the closely related ThiT from Lactococcus lactis . This binding affinity is significantly higher than most bacterial substrate-binding proteins and transporters, making ThiT one of the highest-affinity vitamin transporters known. This extraordinarily high affinity allows bacteria to effectively scavenge thiamine from environments where this essential vitamin may be present at extremely low concentrations. Similar high-affinity binding has been observed for other S-components in ECF transporters, suggesting this is a general feature important for their biological function .

What structural features enable ThiT to bind thiamine with such high affinity?

The high-resolution crystal structure of ThiT from Lactococcus lactis reveals an extensive network of protein-substrate interactions that explain its remarkable binding affinity. Key structural features include:

  • A binding pocket formed by multiple aromatic residues (including Tyr85, Tyr146, Trp133, and Trp34) that create a "cage" of aromatic side chains surrounding the thiamine molecule

  • Specific hydrogen bonding interactions involving residues like Glu84, His125, and Asn151

  • A water-mediated interaction with Tyr146

  • Loops L1, L3, and L5 that form a protective cap over the binding site

These extensive interactions provide both specificity and stability to the thiamine-ThiT complex, resulting in the picomolar affinity observed experimentally.

What expression systems are most effective for producing recombinant ThiT?

Based on research findings, Lactococcus lactis NZ9000 has proven to be a particularly suitable host for ThiT expression with properties complementary to those of Escherichia coli . This is significant because membrane proteins are often challenging to express in heterologous systems.

Table 1: Comparison of Expression Systems for Recombinant ThiT

Expression SystemAdvantagesLimitationsApplications
Lactococcus lactis NZ9000Native-like membrane environment, Suitable for structural studies, Complementary to E. coliRequires specialized vectors and protocolsCrystal structure determination, Functional studies
Escherichia coliWell-established protocols, High yields possible, Simple genetic manipulationMay require optimization for membrane proteinsTransport assays, Mutation studies, Protein-protein interaction analysis

For functional transport studies, co-expression of ThiT with the energizing module (EcfAA'T) in E. coli has been demonstrated to produce functional transporters capable of thiamine uptake .

How can researchers measure thiamine transport activity mediated by ThiT?

Thiamine transport can be measured using radioactively labeled thiamine ([³H]thiamine) uptake assays in recombinant cells expressing ThiT with or without the energizing module. The methodology involves:

  • Expression of ThiT alone or co-expression with the EcfAA'T energizing module in the chosen host system

  • Energizing cells with glucose prior to the assay

  • Incubation with radiolabeled thiamine at physiological conditions

  • Sampling at various time points and measuring radioactivity after washing cells to remove unbound thiamine

  • Quantification of uptake as pmol per unit of cell density over time

Critical controls include comparing uptake in cells expressing ThiT alone versus ThiT with the energizing module, and using cells harboring empty expression vectors. Research demonstrates that ThiT alone does not support thiamine transport, but robust uptake occurs when co-expressed with the complete ECF transport system .

What methods are effective for studying ThiT-substrate binding independent of transport?

Thiamine binding to ThiT can be measured independently of transport using several methods:

  • Incubation with labeled substrate at low temperature: ThiT binding can be measured by incubating intact cells with labeled substrate at 4°C, conditions under which transport is negligible but binding still occurs

  • Membrane preparation assays: The high-affinity thiamine-binding component can be isolated in membrane preparations and characterized through binding assays with radiolabeled thiamine

  • Purified protein studies: Using purified ThiT for binding studies with various techniques including:

    • Isothermal titration calorimetry (ITC)

    • Surface plasmon resonance (SPR)

    • Fluorescence-based binding assays

    • Equilibrium dialysis

The binding characteristics determined using these methods indicate that binding is insensitive to iodoacetate and occurs at a level (0.5 nmol per 10^10 cells) nearly 20-fold higher than could be accounted for by facilitated diffusion .

What is the molecular mechanism of thiamine transport by the ThiT-ECF complex?

The transport mechanism appears to involve several distinct steps and molecular features:

  • High-affinity substrate capture: ThiT binds thiamine with picomolar affinity at the extracellular side of the membrane

  • Association with the energizing module: ThiT interacts with the EcfT subunit of the energizing module through a conserved alanine motif (AxxxA) in transmembrane helix 1

  • ATP-dependent conformational changes: ATP binding and hydrolysis in the nucleotide-binding domains (NBDs) of the energizing module trigger conformational changes

  • Substrate release mechanism: The proposed mechanism involves rearrangement of the membrane-embedded L1 loop, which could open a lateral gate for thiamine facing the EcfT subunit. This repositioning disrupts interactions with substrate-binding residues, reducing binding affinity and allowing thiamine to enter the translocation pathway

This mechanism is distinct from conventional ABC transporters and represents a unique transport paradigm where the substrate-binding protein (S-component) is an integral part of the translocating complex rather than a peripherally associated component .

How do mutations in the ThiT alanine motif affect transporter function?

Mutations in the conserved alanine motif (AxxxA) in transmembrane helix 1 of ThiT have profound effects on transporter function:

  • The individual mutations A15W and A19W completely abolish transport activity, even though the mutant proteins are expressed at levels comparable to wild-type ThiT

  • These mutations likely disrupt the critical interaction between ThiT and the EcfT component of the energizing module

  • Importantly, these mutations do not appear to affect thiamine binding, demonstrating a separation between the binding and transport functions of ThiT

This evidence supports the critical role of the alanine motif in mediating protein-protein interactions within the membrane environment, consistent with the known role of small amino acid tetrads in promoting helix-helix interactions between membrane proteins .

What is the relationship between the structure of ThiT and its dynamic interaction with the energizing module?

The structural basis for the dynamic interaction between ThiT and the energizing module reveals several key insights:

This modular design provides a flexible transport system that can be adapted to transport various essential nutrients using specific S-components that interact with a common energizing module.

How can ThiT be used as a model system for studying ECF transporters?

ThiT represents an excellent model system for studying ECF transporters for several reasons:

  • The high-resolution crystal structure of ThiT provides detailed molecular insights into substrate binding and recognition

  • The well-characterized high-affinity binding of thiamine allows for precise binding studies with measurable parameters

  • The modular nature of the ECF transport system, with ThiT as the exchangeable S-component, enables investigation of the dynamic assembly and disassembly of transport complexes

  • The availability of functional expression systems and transport assays facilitates structure-function studies through site-directed mutagenesis

Researchers can use ThiT to investigate fundamental questions about membrane transport mechanisms, protein-protein interactions in the membrane, and the molecular basis of substrate specificity.

What insights does ThiT provide into the evolution of vitamin transport systems?

The ThiT transporter system offers several insights into the evolution of vitamin transport in prokaryotes:

  • The structural similarity but low sequence identity between ThiT and other S-components (such as RibU for riboflavin) suggests convergent evolution toward a common fold optimized for vitamin binding and transport

  • The modular architecture of ECF transporters, with specialized S-components interacting with a shared energizing module, represents an efficient evolutionary solution for transporting diverse essential nutrients with minimal genetic redundancy

  • The high-affinity binding properties of ThiT reflect adaptation to environments where thiamine may be scarce, allowing bacteria to effectively compete for limited resources

These insights contribute to our understanding of how bacterial transport systems have evolved to meet nutritional challenges in various ecological niches.

How might understanding ThiT function contribute to antimicrobial development?

Understanding the structure and function of ThiT and similar transporters could contribute to antimicrobial development through several approaches:

  • Since thiamine is an essential vitamin for many bacteria and the ThiT transport system is absent in humans, it represents a potential target for selective inhibition

  • The high-affinity binding site of ThiT could be targeted by substrate analogs designed to block transport while not serving as nutrients

  • Disruption of the ThiT-energizing module interaction, possibly by targeting the conserved alanine motif, could prevent transport of this essential vitamin

  • Structural knowledge of ThiT could guide the design of compounds that specifically target bacterial vitamin transport without affecting human transporters

Such approaches could potentially lead to novel antimicrobials with mechanisms distinct from conventional antibiotics, potentially addressing issues of antimicrobial resistance.

What are the major challenges in studying ThiT structure and function?

Researchers face several challenges when investigating ThiT:

  • Membrane protein expression and purification: As an integral membrane protein, ThiT presents challenges in expression, solubilization, and purification while maintaining native structure and function

  • Reconstitution of complete transport systems: Studying transport function requires successful co-expression or reconstitution of ThiT with the energizing module (EcfAA'T)

  • High-affinity binding measurements: The extremely high affinity (Kd ~120 pM) of ThiT for thiamine requires specialized techniques and careful experimental design to accurately measure binding parameters

  • Distinguishing binding from transport: Experimental approaches must differentiate between substrate binding to ThiT (which can occur independently) and complete transport into cells (which requires the energizing module)

  • Structural studies of the complete transporter complex: While the structure of ThiT alone has been determined, capturing the structure of the complete ECF-ThiT complex represents a significant challenge

How can researchers distinguish between ThiT binding activity and transport function?

Distinguishing between ThiT binding and transport can be accomplished through several complementary approaches:

  • Temperature-controlled experiments: Binding can be measured at 4°C, conditions under which transport is negligible but binding still occurs

  • Energy depletion: Transport is energy-dependent while binding is not, so experiments with de-energized cells can isolate binding from transport

  • Expression system comparison: Expressing ThiT alone versus co-expression with the energizing module (EcfAA'T) allows researchers to separate binding capacity from transport activity

  • Mutational analysis: Certain mutations (such as those in the alanine motif) can disrupt transport while preserving binding, providing tools to dissect these functions

These approaches have revealed that ThiT alone can bind thiamine with high affinity but requires the energizing module for actual transport of the vitamin into the cell .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.