Recombinant Lactobacillus casei Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Functional Role in Cell Wall Biosynthesis

uppP operates within the lipid II cycle, which shuttles peptidoglycan precursors across the cytoplasmic membrane :

  1. UPP Dephosphorylation: Converts UPP → UP, replenishing UP pools for glycan carrier activity .

  2. Bacitracin Resistance: Competes with bacitracin (an antibiotic that binds UPP) by accelerating UPP recycling .

  3. Cross-Linking Modulation: Alters peptidoglycan structure by regulating UP availability, impacting cell wall integrity .

In L. casei, UP is vital for D-Ala-D-Lac-containing peptidoglycan, conferring natural vancomycin resistance . Disrupting uppP halts peptidoglycan recycling, leading to cell lysis .

Research Applications in Vaccine Development

Recombinant L. casei Δupp strains (lacking native uppP) serve as platforms for antigen delivery due to their genetic stability and safety profile :

Table 1: Recombinant L. casei Strains in Vaccine Studies

StrainAntigen ExpressedHost ResponseStability
Δupp ATCC 393PEDV S1 glycoprotein↑ Serum IgG, mucosal IgA; ↑ IFN-γ, IL-10 Stable for 40 generations
Lc-pPG1-Aha1Aeromonas hydrophilaColonizes fish gut; ↑ IL-1β, TNF-α 4.3 × 10⁵ CFU/mL in hindgut

These strains leverage uppP deletion to enable counterselection with 5-fluorouracil (5-FU), ensuring plasmid retention without antibiotics .

Enzyme Kinetics and Inhibitor Interactions

uppP activity is tightly regulated:

  • Substrate Specificity: Acts on UPP but not other lipid pyrophosphates .

  • Inhibition by Bacitracin: Bacitracin-UPP complexes block UP recycling, though L. casei’s intrinsic resistance mitigates this .

  • DgkA Synergy: In Bacillus subtilis, undecaprenol kinase DgkA phosphorylates undecaprenol to UP, compensating for uppP deficits .

Industrial and Therapeutic Relevance

  • Antibiotic Targets: UP metabolism enzymes (e.g., uppP, MraY) are explored for novel Gram-positive antibiotics .

  • Probiotic Engineering: Recombinant L. casei strains expressing uppP variants could enhance stress tolerance or antigen presentation .

  • Biochemical Tools: His-tagged uppP facilitates purification for structural studies or high-throughput inhibitor screening .

Challenges and Future Directions

  • Stability Issues: Recombinant L. casei grows slower than wild-type, necessitating optimization for large-scale use .

  • Host Immune Modulation: Engineered strains must balance antigen expression with avoiding excessive inflammation .

  • Structural Insights: Cryo-EM or crystallography of uppP could reveal mechanisms for targeted drug design .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format readily available in our inventory. However, for specific format requirements, please specify your needs when placing your order, and we will prepare accordingly.
Lead Time
Delivery time may vary based on the purchasing method or location. Kindly consult your local distributors for precise delivery estimates.
Note: Our proteins are standardly shipped with normal blue ice packs. If dry ice shipping is preferred, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
uppP; LCABL_10200; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-272
Protein Length
full length protein
Species
Lactobacillus casei (strain BL23)
Target Names
uppP
Target Protein Sequence
MFDIIKAVIIGIVEGLTEFLPISSTGHIDLVNHVIKLSQSQDFISMFEYVIQFGAILAVV LLYFNKLNPFSKPTAKARNATWQLWAKVIIAVLPSAVVGLPLNSWMDEHLHTPIVVATTL IVYGILFIILENYLKNKSAHITTLADITYQTALLIGLFQVLSIVPGTSRSGATILGALLI GTSRYVATEFSFFLAIPTMVGVLIIKIGKYLWQGNGFSGEQWAVLMTGSIVSFLVAIVAI KWLLKFVQTHDFKPFGWYRIALGAIVLLVMFI
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links
Protein Families
UppP family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the primary function of Undecaprenyl-diphosphatase (UppP) in bacterial cells?

UppP serves as a critical enzyme in the bacterial cell envelope synthesis pathway, specifically in the Lipid II cycle. Its primary function is to dephosphorylate undecaprenyl pyrophosphate (UPP) to undecaprenyl phosphate (UP), which is essential for cell wall peptidoglycan synthesis. This dephosphorylation step is crucial for recycling the lipid carrier and maintaining the cellular UP pool, which subsequently gets loaded with cell wall precursors to form lipid II . Without this dephosphorylation activity, the lipid II cycle would arrest, preventing proper cell wall synthesis and ultimately leading to cell death.

How does UppP differ structurally and functionally from other UPP phosphatases like BcrC?

While both UppP and BcrC catalyze the dephosphorylation of UPP to UP, they belong to different protein families and display distinct functional roles. UppP (homologous to BacA in E. coli) is a member of the undecaprenyl pyrophosphate phosphatase family, while BcrC belongs to the PAP2 superfamily of phosphatases. Functionally, research in Bacillus subtilis has shown that these enzymes can partially complement each other but have specialized roles: BcrC appears more important for resistance against cell envelope-targeting antibiotics like bacitracin, while UppP plays a more prominent role in sporulation processes . Their expression is also regulated differently, with BcrC expression being inducible by cell envelope stress, while UppP expression remains relatively constant .

What are the optimal conditions for expressing recombinant Lactobacillus casei UppP in heterologous systems?

For optimal expression of recombinant L. casei UppP, researchers should consider the following methodological approach:

  • Expression System Selection: Due to UppP being an integral membrane protein, specialized expression systems such as E. coli C41(DE3) or C43(DE3) strains designed for membrane protein expression often yield better results than standard BL21(DE3).

  • Vector Design: Incorporate a cleavable affinity tag (His-tag or Strep-tag) to facilitate purification. Position the tag at the C-terminus to minimize interference with membrane insertion.

  • Induction Conditions: Use lower IPTG concentrations (0.1-0.3 mM) and reduced temperatures (16-25°C) during induction to prevent formation of inclusion bodies.

  • Growth Media: Supplementation with glycerol (0.5-1%) can enhance membrane protein expression and stability.

  • Extraction Protocols: Gentle extraction using mild detergents such as n-dodecyl β-D-maltoside (DDM) or n-octyl-β-D-glucopyranoside (OG) at concentrations just above their critical micelle concentration is recommended to maintain protein functionality .

These conditions should be optimized specifically for L. casei UppP, as membrane proteins often require individualized protocols for successful expression and purification.

How can researchers effectively measure the enzymatic activity of recombinant UppP in vitro?

To effectively measure UppP enzymatic activity in vitro, researchers can employ the following methodological approach:

  • Substrate Preparation: Use synthetic UPP or radiolabeled UPP ([³²P]-UPP) as substrate. Alternatively, fluorescently labeled UPP analogs can be used for non-radioactive assays.

  • Reaction Buffer Optimization: Standard buffer containing 50 mM Tris-HCl (pH 7.5), 100 mM NaCl, 10 mM MgCl₂, and 0.1% DDM or other appropriate detergent to maintain enzyme solubility.

  • Activity Assay Formats:

    • Colorimetric Assay: Measure released inorganic phosphate using malachite green or similar phosphate detection reagents

    • Radiometric Assay: Monitor the conversion of [³²P]-UPP to UP and inorganic phosphate by thin-layer chromatography

    • HPLC-based Assay: Separate and quantify UPP and UP by reverse-phase HPLC

  • Kinetic Parameters Determination: Vary substrate concentrations to determine Km and Vmax values, which typically requires UPP concentrations in the micromolar range.

  • Controls: Include heat-inactivated enzyme as negative control and known active UPP phosphatases (such as BacA from E. coli) as positive control .

Activity assays should account for the membrane-associated nature of both the enzyme and substrate, often requiring careful optimization of detergent conditions to maintain an environment that mimics the native membrane.

What strategies can be employed to overcome challenges in crystallizing UppP for structural studies?

Crystallizing membrane proteins like UppP presents significant challenges. Researchers can employ these advanced strategies:

  • Protein Engineering Approaches:

    • Generate truncated constructs removing flexible regions while preserving core catalytic domains

    • Create fusion proteins with crystallization chaperones (e.g., T4 lysozyme or BRIL)

    • Introduce surface mutations to reduce flexibility and enhance crystal contacts

    • Consider antibody fragment co-crystallization to provide stable interaction surfaces

  • Detergent Screening and Optimization:

    • Systematic screening of detergents beyond standard options (DDM, OG) to include novel amphipols, maltose-neopentyl glycol (MNG) detergents, and lipid cubic phase methods

    • Implement detergent exchange protocols during purification to identify optimal crystallization conditions

  • Alternative Crystallization Methods:

    • Lipidic cubic phase (LCP) crystallization, which better mimics the membrane environment

    • Bicelle crystallization combining lipids and detergents

    • Microseeding techniques to enhance nucleation and crystal growth

  • Computational Approaches:

    • Use protein disorder prediction to identify and modify regions that might impede crystallization

    • Employ molecular dynamics simulations to identify stable conformations for crystallization trials

  • Data Collection Strategies:

    • Microfocus beamlines for small crystals

    • Serial crystallography approaches for microcrystals

These approaches may need to be applied in combination, with iterative optimization based on initial screening results. The structural information obtained would greatly advance understanding of UppP's catalytic mechanism.

How does UppP activity contribute to bacterial cell envelope stress response?

The role of UppP in cell envelope stress response (CESR) is multifaceted and directly connected to lipid II cycle homeostasis:

  • Maintenance of UP Pool: UppP activity ensures adequate levels of UP for peptidoglycan synthesis. When UppP activity is compromised, the resulting UP shortage triggers stress response pathways .

  • Signaling Systems Activation: In Bacillus subtilis, limitations in UPP phosphatase levels (including UppP) are perceived by the extracytoplasmic function (ECF) sigma factor network, particularly the σᴹ regulon. Research has shown that strains with limited UppP activity demonstrate elevated Pᴹ promoter activity, indicating activation of the sigma M-dependent stress response .

  • Interaction with Stress Response Regulators: Interestingly, while UPP phosphatase limitation activates specific stress response pathways, it does not trigger the classical cell envelope stress response (P₁ᵢₐᵢ) that is normally activated by cell wall antibiotics like bacitracin .

  • Feedback Mechanisms: When UppP activity is insufficient, the resulting cell envelope stress can lead to compensatory mechanisms, including altered expression of other UPP phosphatases like BcrC, creating a regulatory network that maintains envelope integrity under stress conditions .

This complex relationship between UppP activity and stress response pathways provides important insights into bacterial adaptation mechanisms and potential antimicrobial targets.

What is the relationship between UppP activity and bacterial resistance to cell wall-targeting antibiotics?

The relationship between UppP activity and antibiotic resistance is complex and multifaceted:

Understanding this relationship has significant implications for developing strategies to overcome antibiotic resistance, potentially through combination therapies targeting both the antibiotic's primary mechanism and the bacterial stress response systems.

What are the consequences of UppP depletion on bacterial cell morphology and division?

UppP depletion has profound consequences on bacterial cell morphology and division processes:

  • Morphological Abnormalities: When UppP levels are severely limited (especially in conjunction with reduced BcrC), bacteria develop significant morphological defects. In B. subtilis, these include bulging, irregular cell shapes, and dramatically increased cell lengths - sometimes extending to filamentous structures over 10 times normal length .

  • Cell Division Defects: UppP-depleted cells often show impaired septum formation, resulting in incomplete cell division and the formation of elongated cells with multiple nucleoids, indicating that chromosome replication continues despite the inability to complete division .

  • Cell Wall Integrity Issues: The morphological defects observed in UppP-depleted cells reflect fundamental problems in cell wall synthesis and integrity. The lipid II cycle disruption prevents proper peptidoglycan incorporation, leading to weakened cell walls and abnormal expansion patterns .

  • Growth Rate Effects: Severe UppP limitation results in significantly reduced growth rates. This growth defect is directly proportional to the degree of UppP depletion, with complete absence of both UppP and BcrC being synthetically lethal in B. subtilis .

  • Sporulation Defects: In sporulating bacteria like B. subtilis, UppP depletion has particularly dramatic effects on sporulation efficiency. UppP appears to be the primary UPP phosphatase responsible for the lipid II cycle during sporulation, with deletion mutants showing drastically reduced formation of heat-resistant, phase-bright spores (as low as 0.04% of wild-type levels) .

These observations highlight the essential nature of UppP for maintaining normal bacterial cell morphology and division processes, particularly in specific developmental contexts like sporulation.

How does the activity and structure of Lactobacillus casei UppP compare to homologs in other bacterial species?

A comparative analysis of L. casei UppP with homologs in other bacterial species reveals important evolutionary and functional insights:

SpeciesIdentity to L. casei UppPTransmembrane DomainsCatalytic ResiduesSpecialized Functions
B. subtilis UppP~45%7-8ConservedCritical for sporulation
E. coli BacA~35%7-8ConservedAccounts for ~75% of UPP phosphatase activity
S. aureus BacA~40%7-8ConservedContributes to cell wall antibiotic resistance
L. casei UppP100%7-8ReferenceRole in probiotic cell wall integrity
  • In B. subtilis, UppP (homologous to BacA) works alongside BcrC and is essential for efficient sporulation .

  • In E. coli, the BacA homolog constitutes approximately 75% of the total UPP phosphatase activity .

  • L. casei UppP likely reflects adaptations specific to the Lactobacillus genus, potentially related to their probiotic properties and unique cell envelope characteristics.

The variations in sequence, particularly in regions outside the catalytic domain, likely reflect adaptations to specific physiological contexts across bacterial species, while maintaining the core enzymatic function.

What experimental approaches can be used to identify species-specific differences in UppP function?

To systematically investigate species-specific differences in UppP function, researchers can employ several complementary experimental approaches:

  • Heterologous Expression and Complementation Studies:

    • Express UppP homologs from different bacterial species in a common host with depleted or deleted native UPP phosphatases

    • Assess the ability of each homolog to restore normal growth, morphology, and stress resistance

    • Quantify complementation efficiency through growth rate measurements and microscopic analysis

  • Biochemical Characterization:

    • Purify recombinant UppP proteins from multiple species using identical protocols

    • Compare enzymatic parameters (Km, kcat, substrate specificity) under standardized conditions

    • Analyze pH optima, temperature stability, and cofactor requirements across homologs

  • Structural Biology Approaches:

    • Generate structural models or crystal structures of UppP homologs

    • Identify species-specific differences in active site architecture or membrane topology

    • Perform molecular dynamics simulations to assess structural flexibility differences

  • Domain Swapping and Mutagenesis:

    • Create chimeric proteins by swapping domains between UppP homologs

    • Introduce site-directed mutations at non-conserved residues

    • Evaluate how these modifications affect function in vivo and in vitro

  • Transcriptional and Translational Regulation Analysis:

    • Compare promoter structures and expression patterns of uppP genes across species

    • Identify species-specific regulatory elements that control UppP expression

    • Assess post-translational modifications that might differ between species

These approaches would generate comprehensive data on how UppP function has evolved across bacterial lineages, potentially revealing adaptations to different environmental niches or cell envelope architectures.

What evidence supports UppP as a potential target for novel antimicrobial development?

Multiple lines of evidence support UppP as a promising antimicrobial target:

  • Essentiality: UPP phosphatase activity is essential for bacterial viability. In B. subtilis, the synthetic lethality of uppP and bcrC deletions demonstrates that cells cannot survive without UPP phosphatase function . This essentiality makes UppP an attractive target as inhibition would be bactericidal.

  • Conservation and Selectivity: UppP homologs are widely conserved across bacterial species but absent in mammals, providing potential selectivity for antimicrobial targeting. The structural differences between bacterial UPP phosphatases and mammalian phosphatases further enhance the potential for selective inhibition.

  • Synergy with Existing Antibiotics: Targeting UppP could potentiate the activity of existing cell wall-targeting antibiotics. Research shows that reduced UppP activity increases sensitivity to bacitracin and potentially other cell wall antibiotics .

  • Limited Redundancy: While some bacteria possess multiple UPP phosphatases, their specific roles are often non-redundant. In B. subtilis, neither BcrC nor UppP alone can fully compensate for the loss of the other, suggesting that inhibiting even one UPP phosphatase would create significant cellular stress .

  • Critical Role in Stress Response: UppP's involvement in cell envelope stress response pathways means that its inhibition would not only directly impact cell wall synthesis but also potentially disrupt bacterial adaptation mechanisms to environmental stresses .

These characteristics collectively establish UppP as a promising antimicrobial target, particularly for combination therapies with existing cell wall-active antibiotics.

What high-throughput screening methodologies can be employed to identify potential inhibitors of UppP?

To identify potential inhibitors of UppP, researchers can implement these high-throughput screening (HTS) methodologies:

  • Enzyme-Based Biochemical Assays:

    • Phosphate Release Detection: Adapt the malachite green assay to detect inorganic phosphate released during UppP-catalyzed UPP dephosphorylation in 384-well format

    • Fluorescence-Based Assays: Develop FRET-based substrates where dephosphorylation triggers a measurable fluorescence signal change

    • Coupled Enzyme Assays: Link UppP activity to secondary enzymes that generate colorimetric or fluorescent signals

  • Cell-Based Phenotypic Screens:

    • Reporter Gene Systems: Engineer bacterial strains with UppP-dependent stress response promoters (like Pᴹ in B. subtilis) driving fluorescent protein expression

    • Growth Inhibition Assays: Screen for compounds that selectively inhibit growth of strains with reduced UppP but not those with UppP overexpression

    • Morphological Screens: Automated microscopy to detect compounds inducing morphological abnormalities characteristic of UppP depletion

  • Target-Based Biophysical Screens:

    • Thermal Shift Assays: Monitor protein thermal stability changes upon compound binding

    • Surface Plasmon Resonance: Screen for direct binding of compounds to immobilized UppP

    • Mass Spectrometry: Identify compounds that modify or bind to UppP through MS detection

  • In Silico Approaches:

    • Structure-Based Virtual Screening: Dock compound libraries against UppP structural models

    • Pharmacophore Modeling: Develop models based on substrate binding requirements

    • Fragment-Based Screening: Identify small molecular fragments that bind to different regions of UppP

  • Counterscreens and Validation:

    • Test hits against mammalian phosphatases to establish selectivity

    • Confirm mechanism of action through enzyme kinetics studies

    • Validate cellular target engagement using proteomics approaches

These methodologies can be implemented in sequence, starting with primary HTS campaigns and progressing to increasingly specific validation assays to identify the most promising UppP inhibitor candidates.

How can researchers utilize UppP as a model to understand broader principles of membrane protein enzymology?

UppP represents an excellent model system for investigating fundamental principles of membrane protein enzymology:

  • Catalysis at the Membrane Interface: UppP catalyzes the dephosphorylation of UPP within the membrane environment, providing insights into how enzymes access water-soluble and lipid-soluble substrates simultaneously. Researchers can use UppP to study how the membrane environment influences catalytic mechanisms and substrate accessibility .

  • Enzyme Conformational Dynamics: UppP likely undergoes conformational changes during catalysis to properly position the UPP substrate and catalytic residues. Investigating these dynamics through techniques such as hydrogen-deuterium exchange mass spectrometry or single-molecule FRET can reveal broader principles about how membrane proteins coordinate structural changes in the constrained membrane environment.

  • Lipid-Protein Interactions: UppP function may be modulated by specific lipid interactions. Researchers can systematically alter membrane composition to determine how lipid environment affects enzyme function, providing insights into lipid-protein interactions relevant to many membrane proteins.

  • Integration with Cellular Homeostasis: UppP's role in cell envelope homeostasis makes it valuable for studying how membrane-embedded enzymes integrate with broader cellular stress response systems. The connection between UppP activity and sigma factor-dependent gene expression exemplifies how membrane protein activity can be translated into transcriptional responses .

  • Evolutionary Adaptation in Membrane Proteins: Comparative studies of UppP across species can reveal how membrane proteins evolve while maintaining core functions, providing insights into the constraints and opportunities in membrane protein evolution.

By developing UppP as a model system, researchers can address these fundamental questions in membrane protein biology while simultaneously advancing understanding of bacterial cell envelope biogenesis.

What are the potential applications of recombinant UppP in synthetic biology and biotechnology?

Recombinant UppP offers several innovative applications in synthetic biology and biotechnology:

  • Engineered Cell Envelope Systems:

    • Controlled expression of UppP could enable precise regulation of cell envelope properties

    • Synthetic circuits incorporating UppP could create bacteria with dynamically adjustable cell wall characteristics for specialized applications

    • Co-expression with other lipid II cycle enzymes could enable engineering of cell envelopes with novel properties

  • Biosensor Development:

    • UppP-based whole-cell biosensors could detect compounds that interact with the lipid II cycle

    • Reporter systems linked to UppP activity could monitor cell envelope stress in various applications

    • Engineered UppP variants could serve as sensors for specific membrane environments or conditions

  • Biocatalysis Applications:

    • Recombinant UppP could be employed for in vitro synthesis of lipid-linked precursors for glycosylation

    • Immobilized UppP systems could facilitate regeneration of lipid carriers in cell-free biosynthetic pathways

    • UppP might be engineered to accept modified substrates for creating novel cell wall analogs

  • Vaccine and Drug Delivery Systems:

    • UppP-mediated modification of bacterial cell surfaces could create novel vaccine delivery vehicles

    • Controlled UppP expression could generate bacteria with modified surface properties for therapeutic applications

    • Engineering UppP activity might allow creation of bacterial ghosts with intact surface structures but inactivated cellular content

  • Protein Engineering Platform:

    • UppP serves as a model for engineering other membrane-embedded enzymes

    • Successful expression and purification systems for UppP could be adapted for other challenging membrane proteins

    • Directed evolution of UppP could yield insights applicable to engineering other membrane enzymes

These applications leverage the unique properties of UppP at the intersection of cell envelope biogenesis, stress response, and membrane biochemistry, offering new tools for synthetic biology approaches.

How might advanced techniques like cryo-EM and molecular dynamics simulations further our understanding of UppP function?

Advanced biophysical techniques can significantly enhance our understanding of UppP function:

  • Cryo-Electron Microscopy (Cryo-EM) Applications:

    • Structural Determination: Cryo-EM can overcome challenges in membrane protein crystallization, potentially revealing the complete structure of UppP in different functional states

    • Conformational Ensembles: Single-particle analysis could identify multiple conformational states that UppP adopts during its catalytic cycle

    • Lipid-Protein Interactions: Visualization of UppP in nanodiscs or native membrane environments could reveal specific lipid interactions that modulate function

    • Complex Formation: Investigation of potential interactions between UppP and other membrane proteins involved in cell wall synthesis

  • Molecular Dynamics (MD) Simulations:

    • Substrate Binding Mechanism: Simulations can elucidate how UPP accesses the active site from within the membrane

    • Water Access Pathways: Identify how water molecules necessary for hydrolysis reach the active site despite the hydrophobic membrane environment

    • Conformational Transitions: Characterize energy barriers between different functional states of the enzyme

    • Membrane Deformation Effects: Understand how UppP activity might locally affect membrane properties and curvature

    • Allosteric Regulation: Identify potential allosteric sites that might influence UppP activity

  • Integration of Methods:

    • Cryo-EM structures could provide starting points for extensive MD simulations

    • Simulation predictions could guide mutagenesis experiments to validate computational findings

    • Combined approaches could reveal functional mechanisms impossible to deduce from either method alone

  • Emerging Techniques:

    • Time-resolved cryo-EM: Could potentially capture UppP in the act of catalysis

    • Cryo-electron tomography: Might visualize UppP distribution and organization in the native membrane context

    • Enhanced sampling techniques: Methods like metadynamics could explore rare conformational transitions in UppP function

These advanced techniques would provide unprecedented insights into the molecular mechanisms of UppP function, potentially revealing novel regulatory mechanisms and opportunities for selective inhibition.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.