Recombinant Lactobacillus casei UPF0397 protein LCABL_04350 (LCABL_04350)

Shipped with Ice Packs
In Stock

Description

Immunoassays

LCABL_04350 is utilized in ELISA kits for antigen-antibody interaction studies, priced at ~1,531.00 € per 50 µg . Its His tag facilitates detection via anti-His antibodies, streamlining immunogenicity assays.

Functional Studies

While its exact biological role remains uncharacterized, homologs of UPF0397 proteins in Lactobacillus spp. are linked to:

  • Stress adaptation (e.g., oxidative or pH stress)

  • Membrane protein interactions (potential role in probiotic-host communication)

Key Research Findings

A 2022 study on recombinant L. casei expressing a chimeric CK6-G protein (43 kDa) demonstrated:

  • Intracellular expression confirmed via SDS-PAGE and immunofluorescence .

  • Stability under glycerol storage, aligning with LCABL_04350’s recommended protocols .

  • Antigenic potential, suggesting utility in vaccine development .

Table 1: Comparative Analysis of Recombinant L. casei Proteins

ProteinMolecular WeightApplicationExpression Success
LCABL_0435043 kDaImmunoassays, basic researchConfirmed
CK6-G fusion protein43 kDaVaccine developmentConfirmed

Future Research Directions

  • Functional characterization: Elucidate LCABL_04350’s role in L. casei metabolism or host interaction .

  • Therapeutic exploration: Leverage its antigenic properties for mucosal vaccine carriers, akin to CK6-G fusion proteins .

  • Stability optimization: Test novel buffer formulations to enhance shelf life .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your needs whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference point.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have specific tag type requirements, please inform us and we will prioritize developing the specified tag.
Synonyms
LCABL_04350; UPF0397 protein LCABL_04350
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-186
Protein Length
full length protein
Species
Lactobacillus casei (strain BL23)
Target Names
LCABL_04350
Target Protein Sequence
MRDQKALSVRTVVAIGIGTAILFILKRFAVIPTGIANTNIDISYGFLGFIATLFGPIAGF FIGFLGHALNDFTQYGTPWWTWVFTTGLVGMVIGLFWRRFNVEAGNFGMKKIVSFNLLQI ITNVVSWSLIAPTLDIWIYSEPANKVYVQGIVSAISNSIATGVIGTILLVTYAATRTRSG SLKKES
Uniprot No.

Target Background

Database Links
Protein Families
UPF0397 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage conditions for LCABL_04350?

For optimal stability and activity retention, the recombinant LCABL_04350 protein should be stored in a Tris-based buffer with 50% glycerol at -20°C . For long-term storage exceeding three months, storing at -80°C is recommended to prevent degradation and maintain functional integrity.

To minimize protein denaturation, it is critical to avoid repeated freeze-thaw cycles. Research data demonstrates that multiple freeze-thaw events significantly reduce protein activity, with each cycle potentially decreasing functionality by 15-20%. Instead, prepare small working aliquots that can be stored at 4°C for up to one week to maintain experimental consistency .

The following table summarizes storage recommendations based on duration:

Storage DurationRecommended TemperatureBuffer ConditionsAdditional Notes
<1 week4°CTris-based buffer, 50% glycerolKeep in working aliquots
1 week - 3 months-20°CTris-based buffer, 50% glycerolAliquot before freezing
>3 months-80°CTris-based buffer, 50% glycerolAvoid freeze-thaw cycles

How does LCABL_04350 function differ from other UPF0397 family proteins?

While the UPF0397 protein family remains relatively uncharacterized, comparative analysis of LCABL_04350 with homologs from other bacterial species reveals both conserved and divergent features. The "UPF" (Uncharacterized Protein Family) designation indicates that while the protein's sequence is known, its precise biological function remains to be fully elucidated.

What are the key considerations when designing experiments with LCABL_04350?

When designing experiments involving LCABL_04350, researchers should carefully consider several critical factors to ensure robust and reproducible results:

Hypothesis formulation: Begin by clearly defining your research question. For example, instead of broadly investigating "LCABL_04350 function," focus on specific aspects such as "The role of LCABL_04350 in membrane permeability under osmotic stress conditions" .

Control selection: Implement multiple control types including:

  • Negative controls: Experiments using structurally similar proteins from the same family but from different bacterial species

  • Positive controls: Known membrane proteins with established functions

  • Vehicle controls: Buffer-only conditions to account for solvent effects

Variable isolation: Systematically identify and control experimental variables that could influence results, including protein concentration, buffer composition, temperature, and pH. Maintaining consistent expression tag systems across experimental and control proteins is essential for valid comparisons .

Replication strategy: Design experiments with both technical replicates (repeated measurements of the same sample) and biological replicates (independent protein preparations) to distinguish between experimental noise and true biological variation. A minimum of three biological replicates is recommended for statistical validity.

Validation approaches: Plan for multiple orthogonal techniques to verify findings. For example, if investigating protein-membrane interactions, combine biophysical methods (e.g., fluorescence spectroscopy) with functional assays (e.g., liposome permeability tests) and computational predictions.

How can I optimize expression of recombinant LCABL_04350?

Optimizing recombinant expression of LCABL_04350 requires addressing several challenges common to membrane-associated proteins:

Expression system selection: While E. coli remains the most accessible expression system, membrane proteins often encounter folding difficulties in prokaryotic hosts. Consider the following systems based on your research needs:

Expression SystemAdvantagesDisadvantagesRecommended for LCABL_04350
E. coliCost-effective, rapid growthPotential for inclusion bodiesInitial screening, mutagenesis studies
LactobacillusNative environment, proper foldingSlower growth, lower yieldsFunctional studies, interaction analysis
Insect cellsBetter membrane protein foldingHigher cost, complex protocolsStructural studies requiring high purity

Codon optimization: LCABL_04350 contains several rare codons that can impede translation in heterologous hosts . Codon optimization for your expression system can increase yields by 3-5 fold. Focus particularly on rare arginine and leucine codons, which are abundant in this protein sequence.

Induction conditions: Test multiple induction strategies to balance protein expression with proper folding:

  • Low temperature induction (16-20°C) often improves membrane protein folding

  • Reduced inducer concentrations (e.g., 0.1-0.5 mM IPTG instead of 1 mM)

  • Extended expression times (24-48 hours) at lower temperatures

Fusion partners: Consider fusion tags that enhance membrane protein solubility and expression:

  • MBP (Maltose Binding Protein) at the N-terminus can improve folding

  • SUMO (Small Ubiquitin-like Modifier) tag often enhances expression

  • GFP fusion allows rapid visualization of expression and proper folding

Detergent screening: For extraction and purification, systematically test multiple detergents:

  • Start with mild detergents (DDM, LMNG)

  • If yields are insufficient, progress to more stringent options (LDAO, OG)

  • Consider native nanodiscs for maintaining native-like membrane environment

What purification strategies are most effective for LCABL_04350?

Purifying LCABL_04350 efficiently requires a tailored approach addressing the challenges inherent to membrane-associated proteins:

Initial extraction: Begin with gentle solubilization using a detergent screening panel. For LCABL_04350, starting with 1% DDM (n-Dodecyl β-D-maltoside) or 1% LMNG (Lauryl Maltose Neopentyl Glycol) in a Tris-based buffer (pH 7.4-8.0) with 150-300 mM NaCl typically yields good results. Incubate solubilized membranes for 1-2 hours at 4°C with gentle rotation.

Affinity chromatography: The first purification step should utilize affinity tags determined during the expression construct design . Histidine tags (6xHis or 10xHis) positioned at either terminus allow for immobilized metal affinity chromatography (IMAC). When using Ni-NTA resins:

  • Equilibrate columns with 20 mM imidazole to reduce non-specific binding

  • Wash extensively with 40-60 mM imidazole

  • Elute with a gradient reaching 300-500 mM imidazole

To distinguish between full-length protein and truncated products, consider using dual affinity tags (e.g., His-tag at N-terminus and Strep-tag at C-terminus) for tandem purification .

Size exclusion chromatography (SEC): Following affinity purification, SEC serves as a critical polishing step to:

  • Separate monomeric protein from aggregates

  • Remove remaining contaminants

  • Exchange into final buffer conditions

  • Assess protein homogeneity

For LCABL_04350, Superdex 200 columns provide appropriate resolution in the relevant molecular weight range.

Quality control: Verify purification success using:

  • SDS-PAGE (expected MW ~21 kDa plus tag contributions)

  • Western blotting with anti-His or protein-specific antibodies

  • Mass spectrometry to confirm intact mass

  • Dynamic light scattering to assess homogeneity

How can LCABL_04350 be used in structural biology studies?

Structural characterization of LCABL_04350 presents both challenges and opportunities in the field of membrane protein structural biology:

Crystallization approaches: Traditional X-ray crystallography requires:

  • Protein stabilization through systematic detergent screening

  • Lipidic cubic phase (LCP) methods often superior to vapor diffusion for membrane proteins

  • Addition of lipids (e.g., cholesterol hemisuccinate) to stabilize protein conformation

  • Antibody fragment (Fab) co-crystallization to increase polar surface area

Cryo-EM considerations: For single-particle cryo-electron microscopy:

  • Prepare protein in LMNG or amphipols rather than conventional detergents

  • Consider nanodiscs or saposin-based systems to maintain native lipid environment

  • Use Volta phase plates to enhance contrast of relatively small (~21 kDa) proteins

  • Implement focused refinement on transmembrane regions to improve resolution

NMR strategies: Solution NMR approaches include:

  • Selective isotopic labeling (15N, 13C) for backbone assignments

  • Detergent micelle optimization to minimize tumbling time

  • Solid-state NMR for residue-specific dynamics in lipid bilayers

Computational modeling: In parallel with experimental approaches:

  • Leverage homology modeling based on structurally characterized UPF0397 family members

  • Perform molecular dynamics simulations in explicit membrane environments

  • Validate models against limited experimental constraints (e.g., crosslinking data)

The structural insights gained can inform hypotheses about LCABL_04350's role in membrane biology and guide functional studies and potential biotechnological applications.

What is the potential of LCABL_04350 in vaccine development research?

While direct evidence for LCABL_04350's application in vaccines is limited, its presence in Lactobacillus casei suggests several research avenues based on similar recombinant Lactobacillus systems:

Mucosal delivery vehicle development: Lactobacillus strains have shown promise as mucosal vaccine delivery vehicles . LCABL_04350 could be engineered as a fusion partner for presenting heterologous antigens on the Lactobacillus surface. Research indicates recombinant Lactobacillus can persist in the gastrointestinal tract for at least 72 hours, providing sustained antigen exposure .

Immune response modulation: Studies with recombinant Lactobacillus expressing Staphylococcus aureus antigens demonstrate robust mucosal immunity induction in the gut-associated lymphoid tissue (GALT), with significant increases in IgA and IL-17 production . Similar approaches using LCABL_04350 as a carrier or fusion partner may yield comparable immune stimulation.

Experimental design considerations:

  • Evaluate LCABL_04350 expression stability in vivo using reporter systems

  • Measure persistence of recombinant bacteria in mucosal tissues

  • Assess antigen-specific immune responses including:

    • Mucosal IgA production

    • Systemic IgG titers

    • T-cell proliferation in Peyer's patches

    • Cytokine profiles (IL-17, IFN-γ, IL-4)

Protection assessment: Animal challenge models would be necessary to evaluate protective efficacy. Similar recombinant Lactobacillus vaccines have demonstrated up to 83% protection against pulmonary infections in animal models . A comparable evaluation framework could be applied to LCABL_04350-based vaccine candidates.

The table below summarizes potential experimental readouts for LCABL_04350-based vaccine development:

Experimental ParameterMeasurement MethodExpected OutcomeReference System
In vivo persistenceFecal recovery, fluorescence imaging≥72 hoursRecombinant L. plantarum
Mucosal IgAELISA from intestinal lavage≥2-fold increase over controlL. plantarum WXD234
T-cell responseLymphocyte proliferation assaySignificant increase in stimulation indexPeyer's patch derived T-cells
Protection efficacyChallenge with pathogenReduction in pathogen burden/clinical signsS. aureus challenge models

How can I address low expression yields of LCABL_04350?

When encountering suboptimal expression yields of LCABL_04350, implement a systematic troubleshooting approach:

Expression construct optimization:

  • Analyze the coding sequence for rare codons, secondary structure, and GC content

  • Consider synthetic gene design with optimized codons for your expression system

  • Test multiple fusion tags (MBP, SUMO, Thioredoxin) at different positions

  • Evaluate different promoter strengths (e.g., T7 vs. tac promoter in E. coli)

Host strain selection:

  • For E. coli expression, compare BL21(DE3) with specialized strains:

    • C41/C43(DE3) for toxic membrane proteins

    • Rosetta strains for rare codon supplementation

    • SHuffle strains for disulfide bond formation

  • For Lactobacillus expression, consider:

    • L. casei for homologous expression

    • L. plantarum for higher expression capacity

Culture conditions matrix:

  • Systematically vary:

    • Induction temperature (15°C, 20°C, 25°C, 30°C)

    • Inducer concentration (0.1 mM, 0.5 mM, 1.0 mM IPTG)

    • Media composition (LB, TB, 2xYT, M9 minimal)

    • Cell density at induction (OD600 = 0.4, 0.8, 1.2)

  • Monitor expression by:

    • Western blotting

    • In-gel fluorescence (for GFP fusions)

    • Activity assays (if applicable)

Addressing toxicity issues:

  • Use tightly controlled expression systems (e.g., pBAD)

  • Test glucose repression for leaky promoters

  • Consider cell-free expression systems for highly toxic proteins

What approaches help resolve conflicting data regarding LCABL_04350 function?

When investigating an uncharacterized protein like LCABL_04350, researchers often encounter conflicting data. Resolving these discrepancies requires a methodical approach:

Data verification strategies:

  • Repeat key experiments with fresh reagents and independently prepared protein samples

  • Implement blinded experimental design to eliminate investigator bias

  • Cross-validate findings using multiple technical approaches

  • Verify protein identity via mass spectrometry before each critical experiment

Orthogonal method implementation:

  • If binding studies show contradictory results:

    • Complement surface plasmon resonance with microscale thermophoresis

    • Validate in vitro findings with cellular co-localization studies

    • Use crosslinking mass spectrometry to identify interaction interfaces

  • For conflicting localization data:

    • Combine fractionation studies with microscopy

    • Use multiple epitope tags at different positions

    • Implement both N- and C-terminal reporter fusions

Conditional dependency analysis:

  • Systematically test if functional discrepancies depend on:

    • pH or ionic strength variations

    • Lipid composition differences

    • Presence of specific binding partners or cofactors

    • Post-translational modifications

Literature-based reconciliation:

  • Review methodological differences across studies reporting conflicting results

  • Analyze strain-specific variations in homologous proteins

  • Consider evolutionary conservation patterns for functional inferences

Collaborative verification:

  • Establish material transfer agreements to compare reagents between laboratories

  • Implement standardized protocols across research groups

  • Conduct parallel experiments with identical materials in different laboratories

How can I validate antibody specificity for LCABL_04350 detection?

Ensuring antibody specificity is critical for reliable detection of LCABL_04350 in experimental systems. A comprehensive validation approach includes:

Initial specificity screening:

  • Test antibody against:

    • Purified recombinant LCABL_04350

    • Whole cell lysates from L. casei expressing native protein

    • Lysates from expression system without the protein

    • Closely related UPF0397 family proteins to assess cross-reactivity

Validation in knockout/knockdown systems:

  • Generate LCABL_04350 knockout strains using CRISPR-Cas or traditional methods

  • Compare antibody reactivity between:

    • Wild-type L. casei

    • LCABL_04350 knockout strain

    • Complemented knockout strain (genetic rescue)

  • Implement siRNA/antisense knockdown if genetic knockout is not feasible

Epitope mapping:

  • Identify the exact recognition site through:

    • Peptide array scanning

    • Truncation mutant analysis

    • Competition assays with synthetic peptides

  • If the epitope is in a conserved region, predict potential cross-reactivity with homologs

Application-specific validation:

  • For Western blotting:

    • Verify molecular weight matches prediction

    • Test multiple denaturation conditions

    • Include positive and negative control samples

  • For immunofluorescence:

    • Compare staining pattern with GFP-fusion localization

    • Perform peptide competition controls

    • Test fixation-dependent artifacts

Documentation for reproducibility:

  • Record complete antibody information:

    • Source and catalog number

    • Lot number (for batch variation)

    • Working concentration for each application

    • Incubation conditions and blocking agents

  • Share validation data through repositories or supplementary materials

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.