Recombinant Lactobacillus casei UPF0756 membrane protein LCABL_15860 (LCABL_15860)

Shipped with Ice Packs
In Stock

Description

Role in L. casei Physiology

  • Microvesicle (MV) Cargo: LCABL_15860 was identified in membrane vesicles (MVs) released by L. casei BL23, which are enriched in proteins involved in adhesion, stress response, and host interaction . MVs from this strain exhibit antibiofilm activity against pathogens like Salmonella enterica, though LCABL_15860’s direct contribution requires further validation .

  • Hypothetical Adhesion Function: While not experimentally confirmed, LCABL_15860 shares domain architecture with bacterial adhesins, suggesting potential roles in mucosal binding or extracellular matrix interactions .

Biotechnological Applications

  • Recombinant Protein Production: Commercially available as a research-grade antigen for ELISA and antibody development (e.g., Creative BioMart, MyBioSource) .

  • Genetic Engineering Tool: The LCABL_13040-50-60 recombineering system from L. casei has been repurposed for high-efficiency chromosomal integration of heterologous genes, though this system is distinct from LCABL_15860 .

Research Gaps and Future Directions

  • Functional Characterization: The protein’s exact biological role in L. casei BL23—whether in membrane integrity, adhesion, or signaling—remains unconfirmed.

  • Therapeutic Potential: Probiotic-derived MVs are emerging as vehicles for drug delivery or vaccines, but LCABL_15860’s utility in this context is unexplored .

  • Structural Studies: No crystallographic or NMR data exist to elucidate its tertiary structure or ligand-binding domains.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it during order placement. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us and we will prioritize developing the specified tag.
Synonyms
LCABL_15860; UPF0756 membrane protein LCABL_15860
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-153
Protein Length
full length protein
Species
Lactobacillus casei (strain BL23)
Target Names
LCABL_15860
Target Protein Sequence
MESWLFLLGILAIAIVGKNKSLIIGVSAVMVFKLIPQTQNFLKLLQTQGINWGVTVISAA IMVPIATGEIGFKELLNVIKSPAGWIAIGCGVLVAVLSAKGVGLLAMSPEMTVALVFGTI IGVVFLKGIAAGPVIASGLTYVILTVFNLVPGH
Uniprot No.

Target Background

Database Links
Protein Families
UPF0756 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is UPF0756 membrane protein LCABL_15860?

UPF0756 membrane protein LCABL_15860 is a membrane-associated protein expressed in Lactobacillus casei strain BL23. The protein consists of 153 amino acids and belongs to the uncharacterized protein family UPF0756, suggesting its function remains to be fully elucidated . The protein is encoded by the LCABL_15860 gene and contains multiple hydrophobic regions typical of integral membrane proteins, indicating its likely embedding within the bacterial cell membrane.

What structural features can be predicted from the LCABL_15860 sequence?

Based on the amino acid sequence, several structural features can be predicted:

Structural FeaturePredictionSupporting Evidence
Transmembrane domains4-5 membrane-spanning regionsHigh hydrophobicity index in regions MESWLFLLGILAIAIVG, VSAVMVFKLIPQT, IAIGCGVLVAVLSAK, VALVFGTIIGVVFLK, GLTYVILTVFNLVPGH
Secondary structurePredominantly α-helicalAmino acid pattern typical of membrane protein helices
TopologyN-terminus likely cytoplasmicPositive-inside rule analysis
Protein familyUPF0756 family memberSequence homology and UniProt classification (B3WE66)

These structural predictions provide a foundation for experimental design aimed at elucidating the protein's function and interactions within the bacterial membrane .

How should experiments be designed to investigate LCABL_15860 function?

Investigating the function of this uncharacterized membrane protein requires a multi-faceted experimental approach:

  • Gene knockout/knockdown studies:

    • Create deletion mutants in L. casei BL23

    • Assess phenotypic changes (growth rate, stress response, membrane integrity)

    • Use complementation to confirm specificity of observed effects

  • Comparative genomics:

    • Analyze conservation patterns across bacterial species

    • Identify co-evolving genes suggesting functional relationships

    • Examine genomic context for functional hints

  • Protein-protein interaction studies:

    • Bacterial two-hybrid systems

    • Co-immunoprecipitation with membrane fractionation

    • Cross-linking studies followed by mass spectrometry

  • Localization studies:

    • Fluorescent protein fusions

    • Immunogold electron microscopy

    • Subcellular fractionation

These approaches should be designed following experimental principles outlined by Campbell and Stanley, incorporating appropriate controls and considering potential confounding variables in biological systems .

What quasi-experimental approaches are suitable for studying LCABL_15860 in its native context?

When full experimental control is not possible, several quasi-experimental designs can be applied:

  • The Time-Series Experiment:

    • Monitor expression levels of LCABL_15860 under varying environmental conditions

    • Analyze changes in membrane composition or cellular phenotype in temporal relation to protein expression

    • This approach can reveal potential stimuli that regulate the protein's expression or activity

  • Multiple Time-Series Design:

    • Compare wild-type L. casei with LCABL_15860 mutants across different time points

    • Measure multiple parameters simultaneously to capture complex phenotypic changes

    • This design controls for temporal trends that might confound interpretation of results

  • Nonequivalent Control Group Design:

    • Compare different L. casei strains with varying LCABL_15860 expression levels

    • Match strains on other variables to isolate the effect of the protein

    • Statistical analysis must account for potential pre-existing differences between groups

These quasi-experimental approaches provide rigorous frameworks for studying LCABL_15860 when randomization or complete control is not feasible.

How can researchers optimize recombinant expression of LCABL_15860?

Optimizing recombinant expression requires careful consideration of several factors:

ParameterOptimization StrategyRationale
Expression systemE. coli C41(DE3) or C43(DE3) strainsDesigned for membrane protein expression
Vector selectionpET system with tunable promoterControl over expression levels
Induction conditions16-18°C, 0.1-0.5 mM IPTGSlower expression promotes proper folding
Growth mediumTerrific Broth + 1% glucoseEnhanced membrane protein yield
Membrane extractionDifferential centrifugationSeparation of membrane fractions
SolubilizationScreen multiple detergents (DDM, LDAO, CHAPS)Identify optimal solubilization condition
Purification strategyIMAC followed by size exclusionTwo-step purification for higher purity

Following expression, the protein should be stored in a Tris-based buffer with 50% glycerol at -20°C, with working aliquots kept at 4°C for up to one week to avoid degradation from repeated freeze-thaw cycles .

What analytical techniques are most suitable for studying LCABL_15860 structure?

Several complementary techniques can provide structural insights:

  • Circular Dichroism (CD) Spectroscopy:

    • Provides information on secondary structure content

    • Can monitor thermal stability and conformational changes

    • Requires 0.1-0.5 mg/ml of purified protein

  • Nuclear Magnetic Resonance (NMR):

    • Can provide atomic-level structural information

    • Solution NMR for detergent-solubilized protein

    • Solid-state NMR for protein in membrane mimetics

  • X-ray Crystallography:

    • Challenging for membrane proteins but provides high-resolution structures

    • Requires screening of multiple crystallization conditions

    • May require lipidic cubic phase approaches

  • Cryo-Electron Microscopy:

    • Emerging method for membrane protein structure determination

    • Avoids crystallization requirements

    • May be combined with computational modeling

  • Molecular Dynamics Simulations:

    • Provides insights into dynamics and conformational flexibility

    • Can model protein behavior in membrane environments

    • Must be validated with experimental data

Each method has strengths and limitations, and combining multiple approaches provides the most comprehensive structural characterization.

How should researchers approach functional assays for LCABL_15860?

Functional characterization requires hypothesis-driven assays:

  • Transport Function Assessment:

    • Reconstitution into proteoliposomes with fluorescent reporters

    • Measurement of ion/metabolite flux

    • Patch-clamp electrophysiology for potential channel function

  • Signaling Role Investigation:

    • Phosphorylation state analysis

    • Protein-protein interaction networks

    • Second messenger level measurements in response to stimuli

  • Structural Role Examination:

    • Membrane integrity assays in knockout strains

    • Lipid domain organization studies

    • Membrane curvature effects

  • Enzymatic Activity Testing:

    • Substrate screening using bioinformatic predictions

    • Activity assays with purified protein

    • In situ activity measurements with cell fractions

The experimental design should include time-series analysis to capture dynamic responses and appropriate controls to account for detergent or buffer effects on the assays .

What data analysis challenges are specific to membrane proteins like LCABL_15860?

Membrane protein research presents unique analytical challenges:

  • Sequence Analysis Complications:

    • Transmembrane domain prediction algorithms may give conflicting results

    • Homology detection is more difficult due to higher sequence divergence

    • Solution: Use multiple prediction methods and integrate results

  • Structural Data Interpretation:

    • Detergent effects must be distinguished from protein features

    • Lower resolution of membrane protein structures requires careful interpretation

    • Solution: Cross-validate with multiple structural techniques

  • Functional Data Analysis:

    • Distinguishing direct from indirect effects in knockout studies

    • Accounting for lipid environment variations

    • Solution: Use complementary approaches and appropriate controls

  • Proteomics Data Challenges:

    • Membrane proteins are underrepresented in proteomic datasets

    • Hydrophobic peptides are difficult to detect

    • Solution: Use specialized extraction protocols and adjusted search parameters

These challenges necessitate rigorous experimental design and cautious interpretation of results when studying membrane proteins like LCABL_15860.

How might post-translational modifications affect LCABL_15860 function?

Post-translational modifications (PTMs) can significantly impact membrane protein function:

Potential PTMPrediction SitesFunctional ImplicationDetection Method
PhosphorylationSer27, Thr45, Ser92Regulation of protein activity or interactionsMass spectrometry with phospho-enrichment
LipidationN-terminal regionEnhanced membrane associationMetabolic labeling with lipid precursors
GlycosylationAsn residues in extracellular loopsProtein stability and recognitionLectin blotting, glycosidase treatment
Disulfide bondingCysteine residuesStructural stabilityNon-reducing vs. reducing SDS-PAGE

Investigating these modifications requires:

  • Predictive bioinformatic analysis

  • Mass spectrometry-based PTM mapping

  • Site-directed mutagenesis of modified residues

  • Functional comparison of wild-type and mutant forms

  • Analysis of modification dynamics under different conditions

The identification of PTMs could provide critical insights into regulatory mechanisms governing LCABL_15860 function within the bacterial membrane.

What are the most likely interacting partners of LCABL_15860?

Predicting interaction partners requires integrative approaches:

  • Genomic Context Analysis:

    • Genes located in the same operon

    • Conserved gene neighborhoods across species

    • Co-expression patterns from transcriptomic data

  • Structural Prediction Based Partners:

    • Proteins with complementary structural features

    • Membrane proteins with similar topology

    • Proteins involved in similar cellular processes

  • Experimental Validation Strategies:

    • Pull-down assays with tagged LCABL_15860

    • Bacterial two-hybrid screening

    • In vivo cross-linking followed by mass spectrometry

    • Proximity labeling techniques

The interaction network analysis provides context for understanding the protein's role in cellular processes and potential functional mechanisms.

How does the membrane environment influence LCABL_15860 structure and function?

The lipid environment can significantly impact membrane protein behavior:

  • Lipid-Protein Interactions:

    • Specific lipid binding sites may regulate protein activity

    • Annular lipids can affect protein stability and conformation

    • The thickness of the lipid bilayer may influence transmembrane domain organization

  • Membrane Microdomain Association:

    • Potential localization to specific membrane regions

    • Co-localization with functionally related proteins

    • Regulation through membrane fluidity changes

  • Experimental Approaches:

    • Reconstitution into defined lipid compositions

    • Fluorescence microscopy for microdomain localization

    • Deuterium exchange mass spectrometry for lipid-exposed regions

    • Molecular dynamics simulations in different membrane models

Understanding these lipid-protein interactions is crucial for fully characterizing LCABL_15860 function in its native environment.

How should contradictory results in LCABL_15860 research be addressed?

Conflicting data is common in membrane protein research and requires systematic resolution:

  • Methodological Approach:

    • Carefully compare experimental conditions between studies

    • Evaluate differences in protein preparation methods

    • Assess the sensitivity and specificity of different assays

    • Consider strain-specific or growth condition-dependent effects

  • Scientific Framework:

    • Apply Campbell and Stanley's validity framework to assess internal and external validity

    • Consider alternative hypotheses that might reconcile contradictory findings

    • Evaluate statistical power and potential type I/II errors in each study

  • Resolution Strategy:

    • Design experiments that directly test competing hypotheses

    • Use multiple complementary techniques to address the same question

    • Collaborate with laboratories reporting different results

    • Consider context-dependent protein functions as a unifying explanation

What statistical approaches best suit analysis of high-throughput data involving LCABL_15860?

High-throughput experiments generate complex datasets requiring specialized analysis:

Data TypeAnalytical ApproachStatistical Considerations
TranscriptomicsDifferential expression analysisMultiple testing correction; normalization for membrane proteins
ProteomicsQuantitative abundance analysisAdjustment for membrane protein extraction bias
InteractomicsNetwork analysis, enrichment testsFalse discovery rate control; validation of novel interactions
PhenomicsMultivariate analysis of phenotypic dataDimensionality reduction; repeated measures design

Regardless of data type, researchers should:

  • Pre-register analysis plans when possible

  • Use appropriate transformations for non-normal data

  • Account for batch effects and technical variation

  • Validate findings with targeted experiments

  • Consider Bayesian approaches for complex biological systems

How can molecular modeling predictions for LCABL_15860 be experimentally validated?

Computational predictions require robust validation:

  • Structure Prediction Validation:

    • Site-directed mutagenesis of predicted functional residues

    • Accessibility studies using chemical labeling

    • Cross-linking experiments to confirm predicted proximities

    • Electron paramagnetic resonance to measure distances between domains

  • Function Prediction Validation:

    • Design functional assays based on predicted activities

    • Create chimeric proteins to test domain functions

    • Screen for predicted substrates or binding partners

    • Assess phenotypic effects of mutations in predicted functional sites

  • Validation Experimental Design:

    • Include positive and negative controls

    • Test multiple predictions simultaneously

    • Use quantitative rather than qualitative measures

    • Design experiments that can falsify rather than just confirm predictions

This iterative process between computational prediction and experimental validation creates a robust framework for understanding the structure-function relationship of LCABL_15860.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.