Recombinant Lactobacillus delbrueckii subsp. bulgaricus ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Lactobacillus delbrueckii subsp. bulgaricus ATP Synthase Subunit b (atpF)

The recombinant ATP synthase subunit b (atpF) from Lactobacillus delbrueckii subsp. bulgaricus is a bioengineered protein derived from the F0 sector of the bacterial ATP synthase complex. This enzyme is critical for ATP synthesis via proton translocation across the cell membrane. The recombinant form is expressed in Escherichia coli with an N-terminal histidine (His) tag for purification and structural studies .

Functional Role in Bioenergetics

  • Proton Translocation: Coordinates with subunits a and c of the F0 complex to create a proton channel.

  • ATP Synthesis: Drives the rotation of the F1 sector (ATP synthase), coupling proton motive force to ATP production .

Production and Applications

The recombinant protein is synthesized via bacterial expression systems, enabling high-yield production for research. Key applications include:

  • Biochemical Assays: Studying proton translocation efficiency and ATP synthase assembly.

  • Structural Biology: Crystallography or cryo-EM studies to elucidate subunit interactions.

  • Probiotic Research: Investigating stress responses in L. bulgaricus under acidic or nutrient-limited conditions .

Expression Patterns in Different Media

Proteomic studies reveal differential expression of ATP synthase subunits in L. bulgaricus:

ConditionATP Synthase Subunit ExpressionFunction
MRS MediumElevated AtpD and AtpFEnhanced energy metabolism
MilkReduced AtpF compared to MRSAdaptation to nutrient-poor environments
Cold Stress (4°C)Increased stress-responsive proteins (e.g., DnaJ, RecA)Survival mechanisms during refrigeration

Data adapted from proteomic analysis of L. bulgaricus LBB.B5-R .

Genomic Context

  • Strain-Specific Features: While L. bulgaricus 2038 retains a complete lysine biosynthesis pathway, ATP synthase subunits are conserved across industrial strains, suggesting their critical role in bioenergetics .

  • Stress Tolerance: AtpF expression correlates with stress responses, including acid tolerance and cold adaptation .

Challenges and Future Directions

  • Purification Limitations: Repeated freezing/thawing may reduce activity, necessitating optimized storage protocols .

  • Functional Studies: Further research is needed to link atpF expression levels to ATP yields under industrial fermentation conditions.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All protein shipments include standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF; Ldb0707; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-168
Protein Length
full length protein
Species
Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778)
Target Names
atpF
Target Protein Sequence
MEFQPVFAGAEISIINTLWYLIVFSILLLAVKHYAWGPVKDMMEKRRQKVIDDLDQAASD RKKAETLANEREAALKNSRQEATQILSDAKSNAQKTGKQIVSEAMAEASAIREKAKADAA QAETDALNEAREEVADLSVTIAEKVIAKNLSAADQKDLVDQFIKGLND
Uniprot No.

Target Background

Function

F(1)F(0) ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F(1) catalytic core (extra-membranous) and the F(0) membrane proton channel. These are connected by a central and peripheral stalk. ATP synthesis in the F(1) catalytic domain is coupled to proton translocation via the central stalk's rotary mechanism. This protein is a component of the F(0) channel, forming part of the peripheral stalk that links F(1) to F(0).

Database Links

KEGG: ldb:Ldb0707

STRING: 390333.Ldb0707

Protein Families
ATPase B chain family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

Basic Structure and Function of ATP synthase subunit b in L. delbrueckii subsp. bulgaricus

Q: What is the structural organization and functional role of ATP synthase subunit b (atpF) in L. delbrueckii subsp. bulgaricus?

A: ATP synthase subunit b (atpF) in L. delbrueckii subsp. bulgaricus functions as a critical component of the peripheral stalk (stator) in the F0 domain of ATP synthase (Complex V). This protein connects the membrane-embedded F0 portion to the catalytic F1 portion of the enzyme complex. Structurally, ATP synthase consists of two functional domains - F1 and F0. The F1 portion comprises five different subunits (three α, three β, and one each of γ, δ, and ε), while the F0 portion contains multiple subunits including subunit b .

The subunit b is essential for maintaining the stability of the entire ATP synthase complex. It prevents rotation of the α3β3 hexamer relative to subunit a during catalysis, ensuring efficient energy conversion from the proton gradient to ATP synthesis. Without functional subunit b, the mechanical energy from proton movement cannot be properly harnessed for ATP production .

During ATP synthesis, protons pass through F0 via subunit a to the c-ring, causing rotation of two rotary motors: the c-ring in F0 and subunits γ, δ, and ε in F1. This rotational energy drives conformational changes in the catalytic sites located at the interface of α and β subunits, facilitating ATP production through the "binding-change" mechanism .

Expression and Purification Methodologies

Q: What are the optimal expression systems and purification strategies for recombinant L. delbrueckii subsp. bulgaricus ATP synthase subunit b?

A: For recombinant expression of L. delbrueckii subsp. bulgaricus ATP synthase subunit b, several methodological approaches have proven effective:

Expression Systems:

  • E. coli-based expression: The most commonly utilized system due to high yield and simplified manipulation. For example, the pET expression system with T7 promoters has been successfully employed for ATP synthase components .

  • Lactococcus lactis expression: Provides a more native environment for lactic acid bacterial proteins, potentially preserving authentic folding and modifications .

  • Yeast-based expression: Particularly useful when post-translational modifications are important for structure or function .

Purification Protocol:

  • Affinity Chromatography: N-terminal or C-terminal His-tagging (6xHis is standard) enables efficient purification using Ni-NTA columns .

  • Buffer Optimization: Recombinant proteins are typically stable in Tris/PBS-based buffers (pH 7.5-8.0) with 5-50% glycerol or 6% trehalose as stabilizers .

  • Quality Control: SDS-PAGE analysis to confirm >90% purity, often followed by Western blotting with anti-His or specific antibodies .

Storage Recommendations:

  • Store at -20°C/-80°C upon receipt

  • Aliquot to prevent repeated freeze-thaw cycles

  • For lyophilized proteins, reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add 5-50% glycerol for long-term storage

Methodologically, when expressing membrane proteins like ATP synthase subunit b, optimization of detergent conditions during solubilization and purification is critical for maintaining native conformation and stability.

Experimental Applications in Functional Studies

Q: How can recombinant ATP synthase subunit b be used to investigate ATP synthase assembly and function in L. delbrueckii subsp. bulgaricus?

A: Recombinant ATP synthase subunit b serves as a valuable tool for investigating multiple aspects of ATP synthase biology in L. delbrueckii subsp. bulgaricus, particularly through these methodological approaches:

Assembly Studies:

  • Blue Native PAGE (BN-PAGE): This technique separates intact protein complexes and can identify assembly intermediates when specific subunits are absent or modified. Research has shown that ATP synthase can assemble into a complex with a mass of 550 kDa in the absence of certain subunits .

  • Reconstitution Experiments: Purified recombinant subunit b can be combined with other ATP synthase components in liposomes to study the minimal requirements for functional complex formation.

  • Interaction Mapping: Crosslinking studies using recombinant subunit b can identify precise contact points with other ATP synthase components.

Functional Analysis:

  • Complementation Assays: Introducing recombinant subunit b into atpF-deficient strains to assess restoration of ATP synthase activity.

  • Site-Directed Mutagenesis: Systematic mutation of conserved residues in recombinant subunit b to identify amino acids critical for assembly or function.

  • Binding Kinetics: Surface plasmon resonance (SPR) using immobilized recombinant subunit b to determine interaction parameters with other ATP synthase components.

According to studies on ATP synthase assembly, the peripheral stalk (which includes subunit b) is crucial for the stability of the c-ring/F1 complex . The assembly process involves separate formation of the F1 sector, the stator, and the c-ring, followed by their integration - a process in which subunit b plays an essential structural role.

Adaptive Role in Dairy Environment

Q: How does ATP synthase subunit b contribute to L. delbrueckii subsp. bulgaricus adaptation to the dairy environment?

A: ATP synthase subunit b plays a significant role in the adaptation of L. delbrueckii subsp. bulgaricus to the dairy environment through its contribution to energy metabolism and stress responses:

Environmental Adaptation Mechanisms:

  • Energetic Efficiency in Milk: Proteomics studies have revealed that when L. delbrueckii subsp. bulgaricus grows in milk rather than laboratory media (MRS), it shows increased production of proteins involved in energy metabolism, including components of ATP synthase. This adaptation is crucial for efficient energy harvesting in the milk environment .

  • Cold Stress Response: When milk cultures are transferred from 37°C to 4°C (refrigeration temperature), L. delbrueckii subsp. bulgaricus activates stress response proteins. ATP synthase components may be regulated as part of this response to maintain energy production under cold stress conditions .

  • Metabolic Coordination: When cocultured with Streptococcus salivarius subsp. thermophilus (as in yogurt production), gene expression patterns change, affecting purine metabolism and potentially ATP synthase function, demonstrating the complex interplay between these organisms in dairy fermentation .

Data from proteomic analysis shows specific adaptations in enzyme expression patterns:

Growth ConditionEnergy Metabolism ProteinsATP Synthase Response
Milk vs. MRSTpiA, PgK, Eno, SdhA, GapN increasedPotential upregulation of ATP synthase components
Cold storage (4°C)17 proteins increased including stress-related proteins (AddB, UvrC, RecA, DnaJ)Regulatory adjustments to maintain energy production
Co-culture with S. thermophilusDifferential regulation of purine metabolismModified expression affecting ATP generation

This adaptation to the dairy environment demonstrates how ATP synthase components, including subunit b, contribute to the ecological success of L. delbrueckii subsp. bulgaricus in milk fermentation .

Comparison with ATP synthase Components from Other Species

Q: How does the ATP synthase subunit b from L. delbrueckii subsp. bulgaricus compare structurally and functionally with homologs from other bacterial species?

A: The ATP synthase subunit b from L. delbrueckii subsp. bulgaricus exhibits both conserved features and species-specific adaptations compared to homologs from other bacteria:

Comparative Structural Analysis:

OrganismATP synthase subunit b featuresNotable Differences
L. delbrueckii subsp. bulgaricusPart of peripheral stalk, membrane-embedded N-terminus, extended α-helical regionAdaptations for dairy environment
E. coliWell-characterized dimerization domain, interacts with δ subunitMore extensively studied, model system
Human mitochondriaCalled ATP5PB/ATP5F1, higher complexity and additional regulatory featuresMore complex regulation, different physiological role
Yeast (S. cerevisiae)Contains domains for interaction with different F1 subunitsAdditional regulatory functions

Functional Conservation and Divergence:

  • Core Functions: The fundamental role of subunit b in forming the stator that prevents rotation of the α3β3 hexamer is conserved across species .

  • Species-Specific Adaptations: Variations in sequence and structure likely reflect adaptation to different environmental conditions. For L. delbrueckii subsp. bulgaricus, these adaptations may relate to growth in milk and survival during fermentation and cold storage .

  • Interaction Partners: While the core architecture of ATP synthase is conserved, variations exist in how subunit b interacts with other components. For example, research indicates that in yeast, the peripheral stalk includes subunits b, d, h, and 8, while in bacteria like L. delbrueckii, the composition is simpler .

The evolutionary conservation of ATP synthase structure across diverse species highlights its fundamental importance in bioenergetics, while species-specific variations reveal adaptations to particular ecological niches, such as the dairy environment for L. delbrueckii subsp. bulgaricus .

Proteomic Analysis Methodologies

Q: What proteomic approaches are most effective for studying ATP synthase subunit b expression and modification in L. delbrueckii subsp. bulgaricus under different growth conditions?

A: Several sophisticated proteomic approaches have proven effective for studying ATP synthase subunit b expression and modifications in L. delbrueckii subsp. bulgaricus:

Comprehensive Proteomic Methodology:

  • Sample Preparation:

    • Cell-associated protein extraction using mechanical disruption (e.g., bead beating)

    • Membrane protein enrichment using differential centrifugation or phase partitioning

    • Protein solubilization with appropriate detergents (e.g., n-dodecyl β-D-maltoside)

  • High-Resolution Analytical Platforms:

    • Gel-free, shotgun proteomics approach using HPLC-MS/MS

    • Data-dependent acquisition (DDA) for discovery

    • Selected/multiple reaction monitoring (SRM/MRM) for targeted quantification

  • Quantification Strategies:

    • Label-free quantification for comparison across growth conditions

    • Stable isotope labeling for more precise quantification

    • Spectral counting or intensity-based approaches

Based on research methodologies employed with L. delbrueckii subsp. bulgaricus, a successful protocol involved:
"Cell-associated proteins measured by gel-free, shotgun proteomics using high-performance liquid chromatography coupled with tandem mass spectrophotometry. A total of 635 proteins were recovered from all cultures, among which 72 proteins were milk associated (unique or significantly more abundant in milk)" .

Detection of Post-Translational Modifications:

  • Enrichment strategies for phosphopeptides using TiO2 or IMAC

  • Specific detection of acetylation or other modifications using modification-specific antibodies

  • High-resolution mass spectrometry with electron transfer dissociation (ETD) for preserving labile modifications

This methodological approach has successfully revealed differential protein expression patterns between laboratory culture medium (MRS) and milk at different temperatures, providing valuable insights into metabolic adaptations of L. delbrueckii subsp. bulgaricus .

Genetic Manipulation Strategies

Q: What genetic manipulation approaches can be used to study the function of ATP synthase subunit b in L. delbrueckii subsp. bulgaricus?

A: Several sophisticated genetic manipulation approaches can be employed to study ATP synthase subunit b function in L. delbrueckii subsp. bulgaricus:

Gene Knockout and Modification Strategies:

  • Homologous Recombination:

    • Double-crossover approach targeting the atpF gene

    • Selection using counterselectable markers (e.g., upp-based system)

    • Verification through PCR and sequencing

  • CRISPR-Cas9 System:

    • Design of guide RNAs targeting atpF

    • Delivery via electroporation of ribonucleoprotein complexes

    • Screening for edited clones using phenotypic or molecular methods

  • Inducible Expression Systems:

    • Construction of controlled expression vectors for atpF

    • Promoter systems responsive to environmental signals (e.g., xylose-inducible systems)

    • Integration into the chromosome or maintenance as plasmids

Expression Analysis Approaches:

  • Reporter Gene Fusions:

    • Translational fusions with fluorescent proteins (e.g., GFP, EGFP)

    • Luciferase-based reporters for quantitative measurement

    • Tracking of expression under different conditions

For example, a successful approach using EGFP as a reporter and screening marker has been demonstrated in lactobacilli:
"The gene encoding the EGFP was inserted upstream of the fusion gene... and linked with a linker, generating the plasmid pPG-E-α-β2-ϵ-β1... the recombinant pPG-Δ-E-α-β2-ϵ-β1 was electroporated into L. casei 393 competent cells, followed by screening of the positive recombinants by flow cytometry" .

Functional Complementation:

  • Heterologous Expression:

    • Expression of atpF variants in model organisms

    • Assessment of functional complementation in atpF-deficient strains

    • Phenotypic analysis under different growth conditions

  • Site-Directed Mutagenesis:

    • Targeted mutation of conserved residues in atpF

    • Analysis of effects on ATP synthase assembly and function

    • Identification of critical amino acids and domains

These genetic manipulation strategies provide powerful tools for elucidating the specific roles of ATP synthase subunit b in the physiology and dairy adaptations of L. delbrueckii subsp. bulgaricus.

Advanced Research Applications

Q: What are the cutting-edge research applications for recombinant L. delbrueckii subsp. bulgaricus ATP synthase subunit b in bioenergetics and synthetic biology?

A: Recombinant L. delbrueckii subsp. bulgaricus ATP synthase subunit b offers several cutting-edge research applications at the intersection of bioenergetics and synthetic biology:

Bioenergetic Applications:

  • Energy Coupling Mechanisms:

    • Investigation of proton translocation efficiency in reconstituted systems

    • Analysis of how subunit b contributes to the mechanical coupling between F0 and F1

    • Identification of species-specific adaptations affecting energy conversion efficiency

  • Comparative Bioenergetics:

    • Systematic comparison of ATP synthase efficiency across different Lactobacillus species

    • Investigation of how environmental adaptations influence energy conservation strategies

    • Correlation between ATP synthase structure and metabolic capabilities

Synthetic Biology Approaches:

  • Engineered ATP Synthases:

    • Creation of chimeric subunit b proteins combining domains from different species

    • Development of ATP synthases with modified energetic properties

    • Engineering of protein-protein interactions within the ATP synthase complex

  • Biosensor Development:

    • Creation of ATP synthase-based biosensors for monitoring cellular energetics

    • Development of assays for screening compounds affecting bacterial energy metabolism

    • Engineering reporter systems linked to ATP synthase assembly or function

Methodological Innovations:
Research shows that advanced approaches can be developed using recombinant ATP synthase components, such as:

"Using enhanced green fluorescent protein (EGFP) as a screening marker for recombinant lactobacillus... a genetically engineered L. casei 393 strain with non-antibiotic resistance constitutively expressing toxoids... was successfully constructed with a lactobacillus constitutive expression plasmid pPG-T7g10-PPT" .

Similar methodologies could be applied to ATP synthase subunit b research, offering advantages over traditional antibiotic-selection methods. The development of EGFP-marked recombinant proteins allows for flow cytometry-based screening and real-time monitoring of expression and localization in living cells.

Structure-Function Relationship Analysis

Q: How can we correlate the structural features of ATP synthase subunit b with its functional roles in L. delbrueckii subsp. bulgaricus?

A: Investigating the structure-function relationship of ATP synthase subunit b in L. delbrueckii subsp. bulgaricus requires an integrated methodological approach:

Structural Analysis Techniques:

  • Computational Structure Prediction:

    • Homology modeling based on solved structures from related species

    • Molecular dynamics simulations to assess conformational flexibility

    • Prediction of protein-protein interaction interfaces

  • Experimental Structure Determination:

    • X-ray crystallography of isolated subunit b or subcomplexes

    • Cryo-electron microscopy of assembled ATP synthase complexes

    • NMR spectroscopy for dynamic structural elements

Functional Correlation Methods:

  • Domain Mapping:

    • Truncation analysis to identify minimal functional domains

    • Chimeric constructs combining domains from different species

    • Assessment of assembly competence and functional integrity

  • Site-Directed Mutagenesis:

    • Mutation of conserved residues identified through sequence alignment

    • Charge-reversal mutations to test electrostatic interactions

    • Introduction of cross-linkable residues to capture transient interactions

Similar structure-function analysis of subunit b would investigate its role in:

  • Formation of the peripheral stalk

  • Connection between F0 and F1 domains

  • Stability of the entire ATP synthase complex

  • Species-specific adaptations related to the dairy environment

These methodologies allow researchers to systematically map the functional significance of specific structural elements within ATP synthase subunit b, enhancing our understanding of this protein's role in the bioenergetics of L. delbrueckii subsp. bulgaricus.

Interspecies Variations and Evolutionary Adaptations

Q: What are the key evolutionary adaptations in ATP synthase subunit b across different Lactobacillus species, and how do they relate to ecological niches?

A: ATP synthase subunit b exhibits significant evolutionary adaptations across Lactobacillus species that correlate with their diverse ecological niches:

Comparative Genomic Analysis:
A systematic comparison of ATP synthase subunit b sequences across Lactobacillus species reveals patterns of conservation and divergence that reflect ecological adaptations:

Lactobacillus SpeciesEcological NicheNotable Adaptations in ATP Synthase
L. delbrueckii subsp. bulgaricusDairy fermentationAdaptations for growth in milk, cold tolerance
L. salivariusHuman oral/intestinalAdaptations for host-associated environments
L. fermentumDiverse fermentationVersatility in energy metabolism
L. brevisBeer/sourdough fermentationAdaptations for growth in grain-based substrates
L. rhamnosus GGProbiotic applicationsModified energy coupling efficiency

Methodological Approaches for Evolutionary Analysis:

  • Phylogenetic Analysis:

    • Multiple sequence alignment of atpF genes and proteins

    • Construction of phylogenetic trees to reveal evolutionary relationships

    • Calculation of selection pressures (dN/dS ratios) to identify adaptive evolution

  • Functional Genomic Comparison:
    "Functional genomic analysis of lactobacilli has revealed specific adaptations in metabolic pathways. For example, lactose degradation was found constitutive in some strains but regulated in others, reflecting adaptation to different carbohydrate environments" .

  • Structural Bioinformatics:

    • Prediction of species-specific structural features

    • Identification of conservation patterns in functional domains

    • Correlation of sequence variations with specific ecological adaptations

Ecological Significance:
The variations in ATP synthase subunit b likely reflect adaptations to different energy requirements and environmental stresses encountered in various ecological niches. For dairy-adapted species like L. delbrueckii subsp. bulgaricus, these adaptations may include:

  • Efficient energy production at lower pH values

  • Cold tolerance mechanisms for survival during refrigeration

  • Modifications for optimal function in the milk environment

These evolutionary adaptations demonstrate how ATP synthase components have been fine-tuned through natural selection to optimize energy metabolism for specific environmental conditions, contributing to the ecological success of different Lactobacillus species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.