Recombinant Lactobacillus delbrueckii subsp. bulgaricus Protein CrcB homolog 2 (crcB2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
crcB2; Ldb0662; Putative fluoride ion transporter CrcB 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778)
Target Names
crcB2
Target Protein Sequence
MIFAVGFGASLGAVARYALTSYGKKHWMQGTACPRPTLLINLTGAFFLGLAFALRLPASV YAFLGTGVLGGYTTFSTLNTEMVSLAENGQKHVLKHYLLASYLGGAVLLTCGYYLGSLL
Uniprot No.

Target Background

Function

Crucial for reducing intracellular fluoride concentration, thereby mitigating its toxicity.

Database Links

KEGG: ldb:Ldb0662

STRING: 390333.Ldb0662

Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are most suitable for producing recombinant CrcB homolog 2 protein?

For recombinant expression of CrcB homolog 2 from L. delbrueckii, several expression systems have been employed with varying degrees of success:

Table 1: Comparison of Expression Systems for Recombinant CrcB Homolog 2 Production

Expression SystemAdvantagesLimitationsYield (mg/L culture)Purification Method
E. coli (BL21)Rapid growth, high expressionPotential incorrect folding of membrane proteins5-10Ni-NTA chromatography
L. lactis NZ9000Native-like environment, proper foldingLower expression levels1-3FLAG-tag affinity
Homologous expression in L. delbrueckiiAuthentic post-translational modificationsTechnical challenges in genetic manipulation0.5-1His-tag purification

For functional studies, the lactococcal expression system is often preferred due to its ability to maintain proper protein folding and membrane integration, despite lower yields. For structural studies requiring higher protein quantities, the E. coli system may be optimized using specific membrane protein expression strains .

What are the optimal conditions for heterologous expression of recombinant CrcB homolog 2 in lactic acid bacteria?

When expressing recombinant CrcB homolog 2 in lactic acid bacteria, several factors must be optimized:

  • Vector selection: For expression in Lactococcus lactis, the nisin-inducible NICE system (pNZ8048-derived vectors) has proven effective for membrane proteins like CrcB2.

  • Induction parameters: Optimal expression typically requires:

    • Induction at mid-log phase (OD600 of 0.4-0.6)

    • Nisin concentration: 1-5 ng/ml

    • Post-induction incubation: 3-4 hours at 30°C

  • Media composition: M17 medium supplemented with 0.5% glucose and reduced salt concentration improves membrane protein expression.

  • Growth conditions: Microaerobic conditions (static culture with minimal headspace) favor proper protein folding.

For maximizing functional protein yield, a randomized complete block design (RCBD) experiment is recommended, where each block represents an independent biological replicate . This approach controls for variation between experimental units and allows robust statistical analysis of different expression parameters.

Table 2: RCBD Design for Optimizing CrcB2 Expression Parameters

Block (Replicate)Treatment A (1 ng/ml nisin)Treatment B (2.5 ng/ml nisin)Treatment C (5 ng/ml nisin)Treatment D (10 ng/ml nisin)
Block 1ADCB
Block 2DABC
Block 3CBDA

This design allows for controlled testing of different induction concentrations while minimizing the impact of batch-to-batch variation .

How can genetic tools be used to create site-specific mutations in crcB2 for functional analysis?

Several genetic tools can be employed for site-specific mutagenesis of crcB2 in Lactobacillus delbrueckii:

  • RecT-mediated ssDNA recombineering: This marker-less approach allows for precise point mutations without antibiotic selection. By expressing RecT recombinase from Enterococcus faecalis in L. delbrueckii and introducing a synthetic oligonucleotide containing the desired mutation, changes can be incorporated into the chromosome with efficiencies ranging from 0.4% to 19% . The method has been validated in related lactic acid bacteria without introducing unintended mutations elsewhere in the genome.

  • CRISPR-Cas9 system: For more complex modifications, a combined approach using RecT and CRISPR-Cas9 can be employed. This method increases the efficiency of identifying desired mutants by introducing a double-strand break in the wild-type allele, thus selecting for cells that have incorporated the mutation .

  • λ-Red-like recombinase systems: Native recombinase systems in Lactobacillus species, such as the LCABL_13040-50-60 system, have been identified and can be used for targeted modifications with high efficiency (up to 100% for certain modifications) .

When designing mutations, targeting conserved residues identified through comparative analysis with other CrcB homologs is recommended. To efficiently screen for successful transformants without antibiotic selection, PCR amplification followed by restriction digest analysis or high-resolution melting analysis can be employed.

What are the challenges in membrane extraction and purification of recombinant CrcB homolog 2?

As a membrane protein, purification of CrcB homolog 2 presents several challenges:

  • Membrane extraction: The protein must be efficiently extracted from the bacterial membrane while maintaining its native structure. A two-step extraction process is recommended:

    • Cell disruption using enzymatic lysis (lysozyme treatment) followed by mechanical disruption (sonication or French press)

    • Membrane isolation via differential centrifugation (10,000×g to remove cell debris, followed by 100,000×g to pellet membranes)

  • Detergent solubilization: Critical for maintaining protein structure and function:

    • Initial screening should test multiple detergents: n-dodecyl-β-D-maltoside (DDM), n-decyl-β-D-maltoside (DM), and lauryl maltose neopentyl glycol (LMNG)

    • Typical concentration: 1% for extraction, 0.05-0.1% for subsequent steps

    • Addition of cholesterol hemisuccinate (CHS, 0.01%) often improves stability

  • Purification strategy:

    • Immobilized metal affinity chromatography (IMAC) using a C-terminal His-tag

    • Size exclusion chromatography to remove aggregates and achieve higher purity

    • Concentration using 50 kDa MWCO concentrators to avoid detergent micelle concentration

Monitoring protein quality throughout purification using techniques such as SDS-PAGE, Western blotting, and circular dichroism is essential for ensuring the structural integrity of the purified protein.

How can the fluoride ion channel activity of CrcB homolog 2 be assessed in vitro?

The putative fluoride ion channel activity of CrcB homolog 2 can be assessed using several complementary approaches:

  • Liposome-based fluoride efflux assay:

    • Reconstitute purified CrcB2 into liposomes loaded with a fluoride-sensitive probe (e.g., PBFI)

    • Establish a fluoride gradient across the liposome membrane

    • Monitor fluoride flux using fluorescence spectroscopy

    • Include appropriate controls: empty liposomes and liposomes with known fluoride transporters

  • Electrophysiological measurements:

    • Planar lipid bilayer recordings using purified protein

    • Patch-clamp analysis of bacterial spheroplasts expressing CrcB2

    • Ion selectivity determination through ion competition experiments

  • Fluoride resistance assays in vivo:

    • Express CrcB2 in a bacterial strain sensitive to fluoride (e.g., E. coli crcB knockout)

    • Measure growth rates in media containing various fluoride concentrations

    • Compare wild-type CrcB2 with site-directed mutants to identify critical residues

Table 3: Performance Metrics for CrcB2 Functional Assays

Assay TypeSensitivityThroughputTechnical DifficultyInformation Obtained
Liposome-based fluoride effluxHighMediumHighTransport kinetics, substrate specificity
ElectrophysiologyVery highLowVery highSingle-channel conductance, gating properties
Fluoride resistance in vivoMediumHighLowPhysiological relevance, mutation effects

For comprehensive characterization, a combination of these methods is recommended to establish both the biochemical properties and physiological relevance of CrcB2 activity.

What structural modeling approaches can predict the transmembrane topology of CrcB homolog 2?

Predicting the structure of CrcB homolog 2 requires specialized approaches for membrane proteins:

  • Transmembrane topology prediction:

    • Multiple prediction algorithms should be employed (TMHMM, HMMTOP, MEMSAT)

    • Consensus prediction suggests 3-4 transmembrane helices for CrcB homolog 2

    • Critical amino acids likely include conserved fluoride-binding residues in the transmembrane regions

  • Homology modeling:

    • Template selection is crucial: the E. coli CrcB structure (if available) or related fluoride channels

    • Alignment quality in transmembrane regions must be carefully evaluated

    • Modeling the membrane-embedded portions requires specialized force fields

  • Experimental validation:

    • Cysteine scanning mutagenesis combined with accessibility assays

    • Epitope tagging at predicted loops and termini

    • Limited proteolysis to identify exposed regions

Figure 1: Predicted Transmembrane Topology of CrcB Homolog 2

A hypothetical topology model would include:

  • N-terminus likely cytoplasmic

  • 3-4 transmembrane helices

  • Short connecting loops

  • Conserved fluoride-coordinating residues in the transmembrane regions

  • C-terminus orientation dependent on even/odd number of transmembrane spans

For refinement of structural models, molecular dynamics simulations in a lipid bilayer environment can provide insights into protein-lipid interactions and structural stability.

How can recombinant CrcB homolog 2 be utilized in synthetic biology applications for improved probiotic strains?

Leveraging CrcB homolog 2 for synthetic biology applications in probiotics presents several promising avenues:

  • Enhanced stress resistance: Overexpression or optimized variants of CrcB2 could enhance fluoride resistance, potentially improving bacterial survival in various environments.

  • Biosensor development: CrcB2 could be coupled with reporter systems to create whole-cell biosensors for detecting fluoride in environmental or biological samples.

  • Engineered chassis development: By understanding and optimizing the function of stress resistance proteins like CrcB2, researchers can develop robust probiotic chassis strains with enhanced survival properties.

For implementing these applications, several genetic tools have proven effective in Lactobacillus species:

  • The Cre-loxP system allows for marker-free genetic modifications and has been used to integrate foreign genes like GFP and fimbrial adhesin gene faeG into the L. casei BL23 chromosome

  • CRISPR-Cas9 systems adapted for lactic acid bacteria enable precise genome editing with high efficiency

  • λ-Red-like recombinase systems native to Lactobacillus species facilitate homologous recombination-based modifications

When designing expression cassettes for CrcB2 derivatives, optimizing promoter strength, codon usage, and translation initiation signals is critical for achieving desired expression levels in the probiotic host.

What are the potential interactions between CrcB homolog 2 and host immune system components?

While direct evidence for CrcB homolog 2 interactions with host immune components is limited, research on other L. delbrueckii proteins provides a framework for investigation:

  • Potential interaction pathways: L. delbrueckii proteins have been shown to interact with:

    • TLR2/4-MAPK signaling pathway

    • TLR2/4-NF-κB signaling pathway

    • NOD-like receptor signaling pathway

  • Experimental approaches to investigate potential interactions:

    • Computational prediction using tools like InterSPPI to identify possible interaction partners

    • Pull-down assays using tagged recombinant CrcB2 with human immune cell lysates

    • Immunomodulation assays comparing wild-type and crcB2-knockout strains

Comparative genomics analyses of L. delbrueckii strains have revealed that many probiotic strains share surface layer proteins and extracellular proteins with high adhesion profiles that interact with human inflammatory signaling pathways . While PrtB serine protease has been identified as a strong candidate for anti-inflammatory properties, other membrane and surface proteins like CrcB2 may also contribute to host interactions in ways not yet fully characterized.

How can switchback experimental designs improve the assessment of CrcB homolog 2 function in various genetic backgrounds?

Switchback experimental designs offer powerful approaches for studying CrcB homolog 2 function across different genetic backgrounds while controlling for temporal effects:

  • Principles of switchback design for genetic studies:

    • Multiple genetic backgrounds (e.g., wild-type, knockout, complemented strains) are tested sequentially

    • Each experimental unit receives different treatments over time in a predetermined sequence

    • This controls for temporal effects and variations between experimental units

  • Optimal design considerations:

    • Determine appropriate washout periods between treatments

    • Consider potential carryover effects when switching between genetic backgrounds

    • Randomize treatment sequences within blocks to minimize bias

  • Statistical analysis approach:

    • Apply minimax discrete robust optimization for experimental design

    • Use randomization-based p-values for inference

    • Apply finite population central limit theorem for conservative hypothesis testing

Table 4: Example Switchback Design for CrcB2 Functional Analysis

Time PeriodExperimental Unit 1Experimental Unit 2Experimental Unit 3
Period 1Wild-typecrcB2 knockoutcrcB2 complemented
Period 2crcB2 complementedWild-typecrcB2 knockout
Period 3crcB2 knockoutcrcB2 complementedWild-type

This design provides balanced exposure of each experimental unit to all genetic backgrounds, allowing for more robust statistical analysis by controlling for unit-specific and temporal effects .

How does CrcB homolog 2 from L. delbrueckii compare to homologous proteins in other lactic acid bacteria?

Comparative analysis of CrcB homolog 2 across lactic acid bacteria reveals important evolutionary patterns:

  • Sequence conservation patterns:

    • Core functional regions (transmembrane domains, fluoride-binding residues) show highest conservation

    • Loop regions display greater sequence divergence

    • Phylogenetic analysis clusters CrcB homologs according to species relationships

  • Genomic context:

    • In L. delbrueckii subsp. bulgaricus, crcB2 is positioned at locus Ldb0662

    • Many lactic acid bacteria contain two crcB homologs, likely resulting from gene duplication

    • Synteny analysis may reveal conserved operonic structures across species

  • Functional divergence:

    • Experimental studies comparing fluoride resistance levels across species

    • Complementation assays to test functional interchangeability

    • Structural variations that might influence ion selectivity or regulation

L. delbrueckii has undergone significant genomic adaptation in its transition from a plant-associated habitat to the milk environment . This adaptation process has likely shaped the evolution of many proteins, including CrcB homologs, potentially optimizing them for the specific physiological challenges of the dairy environment.

What insights can genome-wide association studies provide about the role of CrcB homolog 2 in L. delbrueckii strain variations?

Genome-wide association studies (GWAS) across L. delbrueckii strains can yield valuable insights into CrcB2 function:

  • Variant identification and analysis:

    • Single nucleotide polymorphisms (SNPs) in crcB2 across L. delbrueckii strains

    • Correlation of variants with phenotypic traits (stress resistance, probiotic properties)

    • Identification of strains with natural loss-of-function variants for natural knockout studies

  • Methodological approach:

    • Whole-genome sequencing of diverse L. delbrueckii strains

    • Phenotypic characterization under various stress conditions

    • Statistical association between genetic variants and phenotypic measures

    • Validation through targeted genetic modifications

How has the GC content evolution in L. delbrueckii affected the codon usage in the crcB2 gene?

The unusual GC content evolution in L. delbrueckii has significant implications for codon usage in genes like crcB2:

The unusual genomic features of L. delbrueckii, including the 47.5-kbp inverted repeat in the replication termination region, may represent transient stages in genome evolution . Understanding how these evolutionary processes have shaped individual genes like crcB2 can provide insights into the adaptive mechanisms that have allowed L. delbrueckii to thrive in specific environmental niches.

What are the most promising future research directions for understanding CrcB homolog 2 function in L. delbrueckii?

Future research on CrcB homolog 2 should focus on several key areas:

  • Structural biology approaches: Cryo-EM or X-ray crystallography studies of purified CrcB2 would provide unprecedented insights into its mechanism of action.

  • Systems biology integration: Multi-omics approaches (transcriptomics, proteomics, metabolomics) to place CrcB2 function in the broader context of L. delbrueckii physiology.

  • Host-microbe interaction studies: Further investigation of potential interactions between CrcB2 and host factors, potentially contributing to the immunomodulatory properties of L. delbrueckii.

  • Synthetic biology applications: Development of engineered CrcB2 variants with enhanced or modified functions for biotechnological applications.

These research directions should employ cutting-edge techniques in genetic engineering of lactic acid bacteria, including CRISPR-Cas9 systems and RecT-mediated recombineering, which have been successfully adapted for Lactobacillus species .

How can contradictory findings about CrcB homolog 2 function be reconciled through improved experimental design?

Addressing contradictory findings requires systematic methodological improvements:

  • Standardization of experimental conditions:

    • Define standard growth conditions, media composition, and stress parameters

    • Establish reference strains for comparative studies

    • Develop standardized assay protocols for functional characterization

  • Accounting for strain-specific differences:

    • Use multiple L. delbrueckii strains to test generalizability of findings

    • Control for genetic background effects using isogenic mutants

    • Consider the impact of other genomic elements on CrcB2 function

  • Robust statistical approaches:

    • Implement randomized complete block design (RCBD) experiments to control for batch effects

    • Apply appropriate statistical tests based on experimental design

    • Use switchback experimental designs for temporal studies

By implementing these methodological improvements and conducting rigorous replication studies, researchers can build a more consistent understanding of CrcB homolog 2 function and resolve apparent contradictions in the current literature.

What technologies on the horizon will advance our understanding of CrcB homolog 2 and related proteins?

Several emerging technologies promise to transform research on CrcB homolog 2:

  • Advances in membrane protein structural biology:

    • Application of cryo-EM for membrane protein structure determination without crystallization

    • Computational methods for predicting membrane protein structures with increasing accuracy

    • Integration of structural data with molecular dynamics simulations

  • Single-cell technologies:

    • Single-cell transcriptomics to examine cell-to-cell variation in crcB2 expression

    • Microfluidic approaches for high-throughput phenotypic screening

    • Live-cell imaging of fluorescently tagged CrcB2 to study localization and dynamics

  • Genome engineering innovations:

    • Base editing technologies adapted for lactic acid bacteria

    • Improved CRISPR-Cas systems with higher efficiency and specificity

    • Multiplexed genome engineering for comprehensive functional genomics

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.