Recombinant Lactobacillus delbrueckii subsp. bulgaricus UPF0397 protein Ldb1710 (Ldb1710)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline for your reconstitution.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Ldb1710; UPF0397 protein Ldb1710
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-186
Protein Length
full length protein
Species
Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778)
Target Names
Ldb1710
Target Protein Sequence
MNKDMWKLSPKNIAALGIGSAVFVIVGRFASIPSGLPNTNFELVYAFLAMIAMIYGPTVG FGVGFIGHVLLDLMMYGQTWWNWNFAAGFLGFFIGLYALRVNIDQGEFSAKEMVIFNVVQ VVANAIVWFLLGSVGDMVLNSEPAAKVFAQAGLTTLMDGLTIAVLGTILLKLYAGSRVKK GSLHKD
Uniprot No.

Target Background

Database Links

KEGG: ldb:Ldb1710

STRING: 390333.Ldb1710

Protein Families
UPF0397 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Ldb1710 and what organism does it come from?

Ldb1710 is a protein classified as belonging to the UPF0397 protein family, originating from Lactobacillus delbrueckii subsp. bulgaricus. It is a full-length protein consisting of 186 amino acids . Lactobacillus delbrueckii subsp. bulgaricus (often abbreviated as L. bulgaricus) is a gram-positive bacterium commonly used in yogurt production and has significant importance in industrial fermentation processes and as a probiotic organism. The designation "UPF" stands for "Uncharacterized Protein Family," indicating that the precise function of this protein family has not been fully elucidated in the scientific literature.

What distinguishes the UPF0397 protein family from other protein families?

The UPF0397 protein family represents a group of uncharacterized proteins with conserved sequence motifs across various bacterial species. When investigating Ldb1710, researchers should perform comparative sequence analysis against other UPF0397 family members to identify conserved domains that might suggest functional roles. Methodologically, this involves:

  • Multiple sequence alignment using tools like Clustal Omega or MUSCLE

  • Identification of highly conserved residues across family members

  • Phylogenetic analysis to determine evolutionary relationships between UPF0397 proteins

  • Structural prediction through homology modeling if crystal structures exist for any family members

These approaches can provide insights into potential functional roles despite the current uncharacterized status of this protein family.

How can researchers confirm the molecular characteristics of recombinant Ldb1710?

To confirm the molecular characteristics of recombinant Ldb1710, researchers should employ a combination of methods:

TechniquePurposeExpected Results
SDS-PAGESize confirmationSingle band at approximately 21-23 kDa (depending on tags)
Western BlotIdentity confirmationSpecific binding with anti-His antibodies (for His-tagged version)
Mass SpectrometryPrecise mass determinationMatching to theoretical mass based on amino acid sequence
N-terminal SequencingConfirm correct start siteMatch to expected N-terminal sequence
Circular DichroismSecondary structure analysisSpectrum characteristic of protein's secondary structure

The recombinant Ldb1710 protein is available as His-tagged version expressed in E. coli, which facilitates purification and detection using standard protocols . When analyzing the purified protein, researchers should consider potential effects of the His-tag on structure and function, possibly requiring control experiments with tag-cleaved versions.

What expression systems are optimal for recombinant Ldb1710 production?

For optimal expression of recombinant Ldb1710, several systems can be considered:

E. coli expression system is most commonly used and has been successfully employed for Ldb1710 production . When using E. coli, consider:

  • BL21(DE3) or Rosetta strains to minimize codon bias issues

  • Temperature optimization (typically 18-30°C for improved solubility)

  • IPTG concentration titration (0.1-1.0 mM)

  • Expression in rich media (LB) versus minimal media (depends on downstream applications)

Alternatively, expression in Lactococcus lactis using specialized vectors like pDP359 could provide a more native environment for the protein, potentially improving folding and solubility . This approach leverages the plasmid's ability to replicate in L. lactis while maintaining compatibility with E. coli for molecular manipulations .

How can researchers design an effective shuttle vector for expressing Ldb1710 in Lactobacillus?

Designing an effective shuttle vector for expressing Ldb1710 in Lactobacillus requires consideration of several critical elements:

  • Origin of replication compatible with both E. coli and Lactobacillus (such as pDP193 component)

  • A complete plasmid from L. delbrueckii sp. containing all necessary replication elements

  • Appropriate selection marker, such as chloramphenicol resistance gene engineered with L. bulgaricus promoter elements

  • Proper transcriptional elements:

    • Native L. bulgaricus promoter (such as the lacS promoter)

    • Accurate positioning of -35 and -10 regions

    • Correct ribosome binding site positioning relative to the start codon

The construction procedure should include:

  • PCR amplification of the promoter region

  • Restriction digestion and ligation of elements

  • Verification of construct integrity by restriction analysis

  • Transformation into E. coli for amplification

  • Electrotransformation into Lactobacillus

A proven example is the pDP359 shuttle vector, which incorporates pDP193 allowing culture in E. coli/Lc. lactis, a complete L. delbrueckii sp. plasmid, and an engineered chloramphenicol resistance gene .

What purification strategy is recommended for His-tagged Ldb1710?

For His-tagged Ldb1710 purification, the following methodological approach is recommended:

Purification StepConditionsNotes
Cell LysisSonication or French press in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazoleAdd protease inhibitors to prevent degradation
ClarificationCentrifugation at 15,000 g for 30 minRemove cell debris and insoluble material
IMACNi-NTA or Co-TALON resin, gradient elution with 20-300 mM imidazoleMonitor elution by A280 and SDS-PAGE
PolishingSize exclusion chromatography using Superdex 75/200Removes aggregates and impurities
ConcentrationUltrafiltration (10 kDa MWCO)Concentrate to 1-5 mg/ml for storage

Quality control should include SDS-PAGE, Western blot, and activity assays if available. For long-term storage, add 10% glycerol and store in aliquots at -80°C to maintain protein stability .

What approaches should be used to investigate the structural properties of Ldb1710?

Investigating the structural properties of Ldb1710 requires a multi-technique approach:

  • Primary structure analysis:

    • Complete sequence verification using mass spectrometry

    • Identification of conserved motifs via bioinformatic analysis

  • Secondary structure determination:

    • Circular Dichroism (CD) spectroscopy to estimate α-helix, β-sheet content

    • FTIR spectroscopy as complementary technique

  • Tertiary structure analysis:

    • X-ray crystallography (requires successful crystallization)

    • NMR spectroscopy for solution structure (if protein size permits)

    • Homology modeling based on related structures

  • Quaternary structure investigation:

    • Size exclusion chromatography with multi-angle light scattering (SEC-MALS)

    • Analytical ultracentrifugation to determine oligomerization state

Given that UPF0397 family proteins are uncharacterized, structural analysis may provide the first insights into potential function through identification of structural homology to proteins of known function.

What experimental methods are appropriate for investigating Ldb1710's biochemical function?

To investigate the biochemical function of the uncharacterized Ldb1710 protein, researchers should employ a systematic approach:

  • Bioinformatic prediction of function:

    • Sequence-based function prediction tools

    • Structural homology modeling with function inference

    • Genomic context analysis (adjacent genes often have related functions)

  • Enzymatic activity screening:

    • General enzymatic assays (hydrolase, oxidoreductase, transferase activities)

    • Substrate screening panels

    • Differential scanning fluorimetry with potential ligands/substrates

  • Protein-protein interaction studies:

    • Pull-down assays using His-tagged Ldb1710 as bait

    • Bacterial two-hybrid system

    • Co-immunoprecipitation with potential partners

  • In vivo functional analysis:

    • Gene knockout/knockdown in L. bulgaricus

    • Phenotypic characterization of mutants

    • Complementation studies

Since the function of Ldb1710 is currently unknown, a broad initial screening approach followed by focused investigation of promising leads represents the most efficient research strategy.

How can researchers troubleshoot expression and solubility issues with recombinant Ldb1710?

When encountering expression or solubility issues with recombinant Ldb1710, systematically address potential problems:

IssueTroubleshooting ApproachMethodological Details
Poor expressionOptimize codon usageSynthesize gene with host-optimized codons or use specialized strains
Adjust induction conditionsTest different temperatures (15-37°C), IPTG concentrations (0.1-1 mM), and induction timing
Evaluate different promotersCompare T7, tac, or native L. bulgaricus promoters
Protein insolubilityExpress as fusion proteinTest MBP, SUMO, or thioredoxin fusion tags
Modify buffer conditionsScreen buffers with different pH (6.0-8.5), salt (100-500 mM NaCl), and additives (glycerol, detergents)
Use specialized host strainsTry strains co-expressing chaperones or with oxidizing cytoplasm
Protein degradationAdd protease inhibitorsUse complete inhibitor cocktail during lysis and purification
Optimize purification speedMinimize processing time, maintain samples at 4°C
Identify proteolytic sitesAnalyze degradation products by mass spectrometry

For Lactobacillus-specific expression, the pDP359 shuttle vector system that has been specifically designed for L. bulgaricus may resolve many expression issues by providing appropriate replication and expression elements .

What factors should be considered when designing experiments to study protein-protein interactions involving Ldb1710?

When designing experiments to study protein-protein interactions involving Ldb1710, researchers should consider:

  • Experimental design factors:

    • Use appropriate controls including:

      • Negative controls (unrelated proteins with similar properties)

      • Tagged-only controls (to identify tag-mediated interactions)

      • Reciprocal confirmation (reverse bait-prey configuration)

    • Validate interactions through multiple techniques

    • Consider native vs. denaturing conditions

  • Technical considerations:

    • Protein concentration effects on non-specific interactions

    • Buffer composition impact on interaction stability

    • Tag position (N- vs. C-terminal) effects on interaction sites

    • Detection sensitivity and specificity

  • Bacterial-specific challenges:

    • Membrane association possibilities

    • Cell wall interactions

    • Integration with bacterial metabolic networks

  • Validation approaches:

    • In vitro reconstitution of complexes

    • Functional assays to verify biological relevance

    • Structural studies of interaction interfaces

Given the uncharacterized nature of UPF0397 family proteins, interaction studies may provide crucial insights into biological function through identification of functional partners or complexes.

How can gene editing approaches be used to study Ldb1710 function in vivo?

Studying Ldb1710 function through gene editing requires specialized approaches for Lactobacillus species:

  • Knockout strategy development:

    • Homologous recombination-based gene replacement

    • Selection marker integration (e.g., chloramphenicol resistance gene)

    • Screening for successful recombinants using PCR verification

  • CRISPR-Cas9 adaptation for L. bulgaricus:

    • Design of specific gRNAs targeting ldb1710

    • Development of Lactobacillus-compatible Cas9 expression

    • Template design for homology-directed repair

    • Optimization of transformation efficiency

  • Phenotypic analysis methodology:

    • Growth kinetics under various conditions

    • Metabolic profiling using LC-MS or GC-MS

    • Stress response evaluation

    • Competitive fitness assessment

  • Complementation studies:

    • Re-introduction of wild-type or mutated ldb1710 using shuttle vectors

    • Analysis of phenotype restoration

    • Domain function mapping through partial complementation

The shuttle vector system described in the patent (pDP359) provides a valuable tool for genetic manipulation in L. bulgaricus, enabling both gene deletion and complementation strategies to study Ldb1710 function .

What approaches can integrate Ldb1710 into systems biology frameworks?

Integrating Ldb1710 into systems biology frameworks requires multi-omics approaches:

  • Transcriptomic analysis:

    • RNA-seq to identify co-expressed genes under various conditions

    • Identification of potential transcriptional networks involving ldb1710

    • Correlation analysis with metabolic pathways

  • Proteomic mapping:

    • Affinity purification-mass spectrometry to identify protein complexes

    • Phosphoproteomics to detect regulatory modifications

    • Protein abundance correlation networks

  • Metabolomic integration:

    • Identification of metabolites affected by ldb1710 manipulation

    • Flux balance analysis to predict metabolic impacts

    • Integration with genome-scale metabolic models

  • Computational modeling:

    • Network analysis to position Ldb1710 in cellular pathways

    • Constraint-based modeling incorporating experimental data

    • Prediction of emergent properties from multi-omics data integration

These approaches can reveal the functional context of Ldb1710 within L. bulgaricus cellular networks, providing insights even without detailed knowledge of its specific biochemical function.

How might understanding Ldb1710 contribute to probiotic research?

Understanding Ldb1710 could advance probiotic research through several pathways:

  • Molecular characterization implications:

    • Identification of unique functional properties specific to L. bulgaricus

    • Potential role in adaptation to the gastrointestinal environment

    • Possible involvement in bacterial-host interactions

  • Biotechnological applications:

    • Engineering improved L. bulgaricus strains with enhanced properties

    • Development of novel expression systems using regulatory elements from ldb1710

    • Creation of reporter systems based on ldb1710 promoter activity

  • Comparative genomics value:

    • Identification of strain-specific variations in ldb1710

    • Correlation of genetic variations with probiotic properties

    • Taxonomic and evolutionary insights into Lactobacillus species

  • Practical research methodologies:

    • Using Ldb1710 as a molecular marker for L. bulgaricus identification

    • Monitoring gene expression under probiotic-relevant conditions

    • Strain development through targeted genetic modification

While the specific function of Ldb1710 remains uncharacterized, research into this protein may reveal novel aspects of Lactobacillus biology relevant to its probiotic applications.

How can contradictory data about Ldb1710 function be reconciled through experimental design?

When facing contradictory data about Ldb1710 function, researchers should implement rigorous experimental approaches:

  • Methodological standardization:

    • Establish consistent protein preparation protocols

    • Standardize assay conditions and reagents

    • Document detailed experimental procedures for reproducibility

  • Multi-laboratory validation:

    • Independent replication of key experiments

    • Blind testing protocols to eliminate bias

    • Statistical meta-analysis of combined datasets

  • Conditional dependency investigation:

    • Systematic testing of environmental factors (pH, temperature, ions)

    • Evaluation of protein modifications or processing requirements

    • Assessment of co-factor or partner protein dependencies

  • Alternative hypotheses formulation:

    • Design critical experiments to distinguish between competing models

    • Develop null hypothesis significance testing framework

    • Implement Bayesian analysis for hypothesis comparison

  • Integration of multiple techniques:

    • Combine in vitro biochemical assays with in vivo functional studies

    • Correlate structural information with functional data

    • Apply complementary methodologies to address the same question

This systematic approach addresses the common challenge of reconciling contradictory findings in uncharacterized protein research.

What expression vectors and strains are recommended for Ldb1710 research?

For optimal Ldb1710 research, consider these expression systems:

SystemVectorHost StrainSelectionApplications
E. colipET-basedBL21(DE3)AmpicillinHigh-yield protein production for biochemical studies
E. coli/L. lactispDP193E. coli/Lc. lactisVariesMolecular manipulation prior to L. bulgaricus transformation
L. bulgaricuspDP359L. bulgaricusChloramphenicolNative expression, functional studies
L. bulgaricuspDP352L. bulgaricusChloramphenicolPromoter studies, reporter constructs

The pDP359 shuttle vector is particularly valuable as it contains:

  • The pDP193 component allowing culture in E. coli/Lc. lactis

  • A complete L. delbrueckii sp. plasmid with all replication elements

  • An engineered chloramphenicol resistance gene with a native L. bulgaricus promoter

This vector system enables sophisticated genetic manipulation in L. bulgaricus, which is typically challenging due to transformation barriers and limited genetic tools.

What are current knowledge gaps and future research directions for Ldb1710?

The study of Ldb1710 presents several knowledge gaps and opportunities for future research:

  • Fundamental characterization needs:

    • Crystal structure determination

    • Biochemical function identification

    • Physiological role in L. bulgaricus

  • Methodological challenges to address:

    • Improved transformation efficiency for L. bulgaricus

    • Development of regulated expression systems

    • Expansion of genetic toolkit beyond basic shuttle vectors

  • Potential research directions:

    • Comparative analysis across Lactobacillus species

    • Influence on probiotic properties

    • Potential biotechnological applications

  • Integration opportunities:

    • Positioning within metabolic networks

    • Role in stress response mechanisms

    • Contribution to industrial fermentation properties

Researchers should prioritize fundamental characterization while developing improved methodological approaches for genetic manipulation in Lactobacillus species. The plasmid technology described in the patent provides a foundation for these studies but requires further optimization and expansion .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.