Recombinant Lactobacillus fermentum ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and confirmed in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If a specific tag type is required, please inform us, and we will prioritize its implementation.
Synonyms
atpF; LAF_0437; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-168
Protein Length
full length protein
Species
Lactobacillus fermentum (strain NBRC 3956 / LMG 18251)
Target Names
atpF
Target Protein Sequence
MFIIAESNQLYLGDMLFYLVSFLIMAALVWHFAWKPVTQMMQKRADKIANDIDSAAQSRE EAQKLAAKRQEELKGSRQEAARIVDNAKQAGESQRAEIIATAQQDAQNLKNQAQKDAEQA RQDALRGAKKDIANLSIEIASKLIHKQLNADDQQALIDTYIEGLVKHE
Uniprot No.

Target Background

Function
F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 domain, containing the extramembranous catalytic core, and the F0 domain, containing the membrane proton channel. These domains are linked by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits.
Database Links

KEGG: lfe:LAF_0437

Protein Families
ATPase B chain family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

Basic Research Questions

  • What is the structural difference between ATP synthase subunit b (atpF) and subunit c (atpE) in Lactobacillus fermentum?

    ATP synthase subunit b (atpF) functions as part of the peripheral stalk connecting the membrane (F0) and soluble (F1) sectors of the ATP synthase complex. It typically forms a homodimer and plays a primarily structural role in the rotary catalytic mechanism . The b subunit has a distinctive structure with a transmembrane domain and an extended cytoplasmic region that contains autonomous domains, including a bend sequence (residues 23–26) and two long α-helical regions (residues 34–78, 85–156) separated by a turn sequence (79–84) .

    In contrast, ATP synthase subunit c (atpE) is part of the F0 sector and functions as a lipid-binding protein . While the b subunit forms the peripheral stalk, the c subunit forms a ring in the membrane-embedded F0 sector that is essential for proton translocation during ATP synthesis .

  • What expression systems are recommended for producing recombinant Lactobacillus fermentum ATP synthase subunit b?

    The optimal expression systems for producing recombinant ATP synthase subunits include:

    Expression SystemAdvantagesConsiderations
    E. coliHigh yield, economical, rapid expressionMay lack proper folding for complex proteins
    YeastPost-translational modifications, proper foldingLonger production time, lower yields
    BaculovirusComplex protein folding, post-translational modificationsMore expensive, technically challenging
    Mammalian cellsMost authentic post-translational processingHighest cost, longest production time

    For Lactobacillus proteins specifically, E. coli is frequently used when proper folding can be achieved, while more complex systems may be necessary if the native structure is difficult to maintain . Selection should be based on the specific experimental requirements and downstream applications.

  • How can researchers verify the purity and identity of recombinant ATP synthase subunit b?

    A multi-method approach is recommended for comprehensive quality assessment:

    • SDS-PAGE analysis to confirm molecular weight and assess initial purity (>90% purity is typically desired)

    • Western blotting with specific antibodies against atpF or included tags

    • Circular dichroism (CD) spectroscopy to verify the expected secondary structure content (predominantly α-helical for the b subunit)

    • Analytical ultracentrifugation to confirm the homodimeric state and assess homogeneity

    • Mass spectrometry for precise molecular weight determination and sequence verification

    • Limited proteolysis combined with mass spectrometry to verify domain organization

    These complementary approaches provide a comprehensive assessment of both purity and structural integrity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.