Recombinant Lactobacillus fermentum Energy-coupling factor transporter transmembrane protein EcfT (ecfT)

Shipped with Ice Packs
In Stock

Description

Introduction to EcfT

The Lactobacillus fermentum Energy-coupling factor transporter transmembrane protein EcfT (ecfT) is a critical component of the Energy-Coupling Factor (ECF) transporters, a subclass of ATP-binding cassette (ABC) transporters. These systems mediate the uptake of essential micronutrients (e.g., folate, riboflavin, cobalamin) in Gram-positive bacteria, including Lactobacillus species. The recombinant form of EcfT is engineered to facilitate structural and functional studies, particularly in understanding vitamin transport mechanisms and potential therapeutic targeting.

Functional Role in Vitamin Transport

EcfT coordinates with the S-component (substrate-binding) and ATPases to facilitate nutrient uptake:

  1. Substrate Binding: The S-component binds extracellular vitamins, triggering a conformational shift.

  2. ATP Hydrolysis: EcfT’s coupling helices undergo structural reorientation, driven by ATPase activity (EcfA/A’), enabling substrate release into the cytoplasm.

  3. Regulation: ECF transporters are essential for bacterial survival, particularly under nutrient-limiting conditions.

Key Studies:

  • Inhibitors targeting ECF transporters (e.g., compound 1) disrupt folate uptake in Lactobacillus delbrueckii, highlighting EcfT’s role in transport cycles .

  • Molecular dynamics simulations confirm EcfT’s involvement in substrate translocation and ATP-dependent conformational changes .

Recombinant Production and Purification

Recombinant EcfT is typically expressed in Escherichia coli and purified via affinity chromatography:

ParameterDetailSource
Expression HostE. coli.
Purity>90% (as per commercial recombinant protein specifications).
Storage-20°C in Tris-based buffer with 50% glycerol.

Inhibitor Discovery

ECF transporters are attractive antibacterial targets due to their absence in humans. Studies using Lactobacillus delbrueckii ECF-FolT2 and ECF-PanT identified inhibitors that block substrate uptake, validating EcfT as a therapeutic target .

Probiotic Interactions

While EcfT’s direct role in Lactobacillus fermentum probiotic efficacy (e.g., strain CECT5716) remains unexplored, its function in nutrient acquisition may indirectly support survival in gut environments.

Comparative Analysis

ECF transporters exhibit conserved structural motifs across species. Below is a comparison of EcfT from Lactobacillus fermentum and related organisms:

ParameterLactobacillus fermentum Bacillus pseudofirmus Lactobacillus helveticus
Length267aa266aa277aa
Uniprot IDD8IIP4D3FRP0A8YXN4
Expression SystemE. coli (inferred)E. coli (His-tagged)E. coli (His-tagged)

Therapeutic Potential

Targeting EcfT could disrupt bacterial nutrient acquisition, offering a novel antibacterial strategy. For example:

  • Vitamin Depletion: Inhibitors blocking EcfT-mediated folate uptake may starve pathogens, particularly those reliant on host-derived nutrients.

  • Broad-Spectrum Activity: ECF transporters are shared across Firmicutes, enabling cross-species targeting .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag type is determined during production. Please inform us of your tag type preference for prioritized development.
Synonyms
ecfT; LC40_0952; Energy-coupling factor transporter transmembrane protein EcfT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-267
Protein Length
full length protein
Species
Lactobacillus fermentum (strain CECT 5716)
Target Names
ecfT
Target Protein Sequence
MNSRVLFGSFVPVDSVLHRLDPRLKLVTCFWYVVIIFFAKGPLTYLLLVAMLGAMIGLSK VPLKMYWAGLKPLLWVIGLTIAIQVLFSSGGHVYWHWGLMAITSGGINQALVILARFILI VLASTVLTATTPPLRLADAIESLMKPLKKIKVPVNQIAMMISIALRFIPTIMDEVNTIVK AQQARGVDFTSGSVYTRVKRMVPIMVPLFVGAFRRAEDLAVAMEARGYDPDQERTRYRQL TWRRPDSIALAVVVIVSVLFFVARILL
Uniprot No.

Target Background

Function

The transmembrane (T) component of an energy-coupling factor (ECF) ABC transporter complex. Unlike classical ABC transporters, this ECF transporter provides the energy for the transport of various substrates.

Database Links
Protein Families
Energy-coupling factor EcfT family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Energy-coupling factor transporter transmembrane protein EcfT in L. fermentum?

The Energy-coupling factor (ECF) transmembrane protein EcfT is a crucial component of the ECF transporter system in Lactobacillus fermentum. ECF transporters belong to a specialized subfamily of ATP-binding cassette (ABC) transporters. Each ECF transporter consists of an energy-coupling module containing a transmembrane T protein (EcfT) and two cytoplasmic ATP-binding cassette proteins (EcfA and EcfA'), along with a substrate-specific component (S component) . The EcfT protein serves as the central transmembrane scaffold that connects the energy-harvesting ATPase domains with the substrate-binding S components, facilitating the transport of essential micronutrients across the cell membrane.

How does EcfT function within the ECF transporter complex?

EcfT functions as the transmembrane domain that anchors the energy-coupling module to the cell membrane. It interacts directly with both the ATP-binding cassettes and the substrate-specific S component. During the transport cycle, ATP hydrolysis by the EcfA and EcfA' components induces conformational changes in EcfT, which are transmitted to the S component, enabling substrate translocation across the membrane. This coupling mechanism represents a unique transport strategy distinct from classical ABC transporters and is critical for the uptake of essential vitamins and micronutrients in L. fermentum.

Why is recombinant expression of L. fermentum EcfT important for research?

Recombinant expression of L. fermentum EcfT enables detailed structural and functional analyses that advance our understanding of nutrient transport mechanisms in this probiotic species. By expressing EcfT as a recombinant protein, researchers can:

  • Perform site-directed mutagenesis to identify critical amino acid residues

  • Generate fusion proteins for localization and interaction studies

  • Produce sufficient quantities for structural determination through X-ray crystallography or cryo-electron microscopy

  • Develop modified L. fermentum strains with enhanced capabilities for therapeutic applications

Studies of L. fermentum strains have already demonstrated significant immunomodulatory and anti-inflammatory properties , making engineered versions potentially valuable for therapeutic development.

What are the key considerations for designing expression constructs for L. fermentum EcfT?

When designing expression constructs for L. fermentum EcfT, researchers should consider:

  • Promoter selection: Choose promoters that function efficiently in Lactobacillus species, such as the P23 promoter from Lactococcus lactis or native L. fermentum promoters.

  • Codon optimization: Adapt the coding sequence to the codon usage bias of L. fermentum to enhance translation efficiency.

  • Signal peptides: Include appropriate signal sequences if secretion or membrane insertion is desired.

  • Affinity tags: Incorporate C-terminal or N-terminal tags (His6, FLAG, etc.) for purification and detection, ensuring they don't interfere with membrane insertion.

  • Terminator sequences: Include strong transcriptional terminators to ensure proper mRNA processing.

The genetic context of the insertion site should also be considered to avoid disrupting essential functions when integrating into the chromosome.

Which vectors are most effective for expressing recombinant L. fermentum EcfT?

The most effective vectors for expressing recombinant proteins in L. fermentum include:

  • pSIP vectors: These provide inducible expression under control of sakacin-based promoters.

  • pLp vectors: These Lactobacillus plantarum-derived vectors often show compatibility with L. fermentum.

  • pIL252/pIL253-derivatives: These shuttle vectors contain origins of replication functional in both E. coli and Lactobacillus species.

When selecting a vector, consider its copy number, stability in L. fermentum, selection markers compatible with food-grade applications (if relevant), and inducible versus constitutive expression capabilities based on experimental needs.

What are the optimal electrotransformation protocols for L. fermentum?

Based on protocols optimized for Lactobacillus species, the following key parameters should be considered for efficient transformation of L. fermentum with ecfT constructs:

  • Growth conditions: Harvest cells in early-logarithmic phase (OD600 0.4-0.6) when grown in MRS broth supplemented with glycine (1-2%) to weaken the cell wall.

  • Washing buffer: Multiple washes with decreasing concentrations of electroporation buffer (typically containing sucrose, MgCl2, and PEG) are essential for removing media components that may cause arcing.

  • Electrical parameters: Optimal conditions typically include:

    • Field strength: 2.0-2.5 kV/cm

    • Capacitance: 25 μF

    • Resistance: 200-400 Ω

    • Cuvette gap: 0.2 cm

  • DNA concentration: Use 0.5-5 μg of purified plasmid DNA.

  • Recovery medium: Immediately after electroporation, add pre-warmed MRS broth supplemented with 20 mM MgCl2 and 2 mM CaCl2.

  • Incubation: Allow for 2-3 hours of recovery at optimal growth temperature (37°C) before plating on selective media.

These parameters may require optimization for specific L. fermentum strains, as transformation efficiency can vary significantly between strains .

How can expression levels of recombinant EcfT be verified and quantified?

Verification and quantification of recombinant EcfT expression can be achieved through multiple complementary approaches:

  • Western blotting: Using antibodies against affinity tags or the EcfT protein itself to detect and semi-quantify expression levels in membrane fractions.

  • RT-qPCR: Measuring transcript levels to assess transcriptional efficiency.

  • Mass spectrometry: For precise identification and quantification of the expressed protein.

  • Fluorescence microscopy: If using fluorescent protein fusions, visualization of membrane localization.

  • Functional assays: Measuring transport of specific substrates to assess functional expression.

MethodAdvantagesLimitationsSample Preparation
Western blottingSpecific detection, size verificationSemi-quantitativeMembrane fraction isolation
RT-qPCRHigh sensitivity, quantitativeMeasures mRNA, not proteinRNA extraction, cDNA synthesis
Mass spectrometryPrecise identification, quantitativeExpensive, complex analysisMembrane protein extraction, digestion
Fluorescence microscopyVisualization of localizationRequires fluorescent tagMinimal processing of intact cells
Functional assaysConfirms biological activityIndirect measurementWhole cells or membrane vesicles

What is the predicted structure of L. fermentum EcfT and how does it relate to function?

The EcfT protein in L. fermentum is predicted to contain multiple transmembrane helices that span the cell membrane, creating a hydrophobic core that facilitates interactions with both the ATP-binding components and the substrate-specific S component. Based on structures determined for ECF transporters in other species, the L. fermentum EcfT likely contains:

  • A conserved coupling module interface that interacts with the ATPase subunits

  • A hydrophobic cavity that accommodates the S component during the transport cycle

  • Specific coupling helices that transmit conformational changes from the ATP-binding site to the substrate-binding domain

These structural features enable the conformational changes necessary for the toppling mechanism proposed for ECF transporters, where the S component rotates within the membrane during substrate transport .

What structural domains are critical for EcfT function?

Critical structural domains in EcfT include:

  • ATP-coupling domain: Interacts with the ATPase components and transmits energy from ATP hydrolysis.

  • S-component interaction interface: Forms specific contacts with the substrate-binding S component.

  • Transmembrane helices: Typically 5-8 helices that anchor the protein in the membrane and form the transport pathway.

  • Conserved coupling helices: Transmit conformational changes throughout the complex during the transport cycle.

  • Specific motifs: Including the conserved "AxxxA" motif often found in transmembrane helices involved in protein-protein interactions within the membrane.

Site-directed mutagenesis of these domains can provide valuable insights into structure-function relationships in the L. fermentum EcfT protein.

What experimental approaches can be used to study the function of recombinant L. fermentum EcfT?

Several experimental approaches can be employed to study the function of recombinant L. fermentum EcfT:

  • Transport assays: Measuring the uptake of radiolabeled or fluorescently labeled substrates in whole cells or membrane vesicles expressing recombinant EcfT.

  • ATPase activity assays: Quantifying ATP hydrolysis rates of the reconstituted ECF complex containing recombinant EcfT.

  • Growth complementation: Testing the ability of recombinant EcfT to restore growth of EcfT-deficient strains in media lacking specific nutrients.

  • Protein-protein interaction studies: Using techniques such as bacterial two-hybrid systems, co-immunoprecipitation, or FRET to study interactions between EcfT and other components of the ECF transporter.

  • Mutagenesis studies: Generating point mutations or truncations to identify residues critical for function.

  • Proteoliposome reconstitution: Reconstituting purified EcfT with other ECF components in artificial liposomes to study transport in a defined system.

How does EcfT modification affect the immunomodulatory properties of L. fermentum?

Modifications to EcfT could potentially alter the immunomodulatory properties of L. fermentum through several mechanisms:

  • Changes in nutrient acquisition: Modified EcfT may alter the uptake of vitamins and micronutrients that influence metabolite production and subsequent immune modulation.

  • Cell surface alterations: Overexpression or modification of membrane proteins like EcfT may affect cell surface properties that interact with host immune cells.

  • Metabolic shifts: Altered nutrient acquisition through modified EcfT could change the metabolic profile of L. fermentum, affecting production of immunomodulatory compounds.

Studies have shown that L. fermentum strains can decrease pro-inflammatory cytokines (IL-2, IFN-γ, IL-4, IL-13, IL-17A) while increasing anti-inflammatory cytokines like IL-10 . The effect of specific EcfT modifications on these properties would need to be determined experimentally, as no direct studies have yet examined this relationship.

What are the critical factors for designing knockout/knockin experiments for ecfT in L. fermentum?

When designing knockout/knockin experiments for ecfT in L. fermentum, researchers should consider:

  • Gene essentiality: Determine whether ecfT is essential for L. fermentum viability under standard growth conditions. If essential, consider conditional knockout strategies.

  • Polar effects: Design knockout strategies that minimize effects on downstream genes in the same operon.

  • Complementation strategy: Prepare complementation constructs expressing wild-type ecfT to confirm phenotypes are specifically due to ecfT deletion.

  • Selection markers: Choose appropriate antibiotic resistance or other selection markers, considering subsequent experimental conditions.

  • Homologous recombination efficiency: Include sufficient lengths of homologous flanking sequences (typically >500 bp on each side) to promote efficient recombination.

  • Verification methods: Plan multiple verification approaches including PCR, sequencing, and functional assays to confirm successful genetic modification.

  • Media supplementation: For knockouts of transport proteins, appropriate media supplementation may be necessary to support growth.

How can CRISPR-Cas9 technology be applied to modify ecfT in L. fermentum?

CRISPR-Cas9 technology offers precise genome editing capabilities for modifying ecfT in L. fermentum:

  • sgRNA design: Select target sequences within ecfT with high specificity and efficiency, avoiding off-target effects. Target the beginning of the gene for knockout experiments.

  • Delivery method: Optimize transformation protocols for introducing Cas9 and sgRNA components, considering either plasmid-based expression or direct introduction of Cas9-sgRNA ribonucleoprotein complexes.

  • Template design: For precise modifications or insertions, design repair templates with appropriate homology arms flanking the desired modification.

  • Cas9 variants: Consider using nickase Cas9 variants for increased specificity or catalytically inactive Cas9 (dCas9) for gene repression without DNA cleavage.

  • Screening strategy: Develop efficient screening methods to identify successfully modified clones, such as mismatch cleavage assays, restriction site insertion/removal, or direct sequencing.

  • Off-target analysis: Validate the specificity of modifications by sequencing potential off-target sites predicted by bioinformatic tools.

How can engineered L. fermentum with modified EcfT contribute to therapeutic applications?

Engineered L. fermentum with modified EcfT could contribute to therapeutic applications through several mechanisms:

  • Enhanced nutrient uptake: Modified EcfT could improve the uptake of specific vitamins or micronutrients, enhancing the metabolic capabilities and competitive fitness of probiotic strains.

  • Delivery system: L. fermentum with modified EcfT could potentially be engineered to uptake and process specific compounds for delivery to the intestinal environment.

  • Improved colonization: Optimized nutrient acquisition could enhance the ability of L. fermentum to colonize and persist in the intestinal environment.

  • Immunomodulation: L. fermentum strains have demonstrated ability to modulate immune responses by decreasing inflammatory cytokines and increasing anti-inflammatory cytokines . Enhanced or modified EcfT function could potentially amplify these beneficial effects.

  • Anti-inflammatory properties: Studies have shown that L. fermentum can alleviate inflammatory conditions like colitis by modulating gut barrier function and reducing leukocyte infiltration . Engineered strains might offer enhanced anti-inflammatory properties.

What considerations are important when evaluating the safety of recombinant L. fermentum expressing modified EcfT?

When evaluating the safety of recombinant L. fermentum expressing modified EcfT, researchers should consider:

  • Genetic stability: Assess the stability of the genetic modification over multiple generations to ensure consistent expression.

  • Antibiotic resistance markers: Avoid or remove antibiotic resistance genes used in the construction process before clinical applications.

  • Horizontal gene transfer risk: Evaluate the potential for transfer of recombinant genes to other microorganisms in the gut environment.

  • Immunogenicity: Test whether the modified EcfT protein triggers undesired immune responses.

  • Metabolic impact: Assess whether the modification alters the production of metabolites that might have systemic effects.

  • Gut microbiome impact: Evaluate how the engineered strain affects the broader gut microbial community.

  • Dosage considerations: Determine appropriate dosing regimens that maximize beneficial effects while minimizing potential risks.

What are common pitfalls in recombinant EcfT expression in L. fermentum?

Common pitfalls in recombinant EcfT expression include:

  • Protein misfolding: As a membrane protein, EcfT may misfold when overexpressed, leading to aggregation or degradation.

  • Toxicity: Overexpression of membrane proteins can disrupt membrane integrity and be toxic to the host cell.

  • Low transformation efficiency: L. fermentum typically shows lower transformation efficiencies compared to model organisms, requiring optimization of transformation protocols .

  • Codon usage issues: Suboptimal codon usage can lead to translational pausing and incomplete protein synthesis.

  • Proteolytic degradation: Recombinant proteins may be subject to degradation by host proteases.

  • Improper membrane insertion: Failure of proper insertion into the membrane can result in non-functional protein.

  • Plasmid instability: Some expression constructs may be unstable in L. fermentum, resulting in loss of the expression cassette over generations.

What strategies can improve the solubility and functionality of recombinant L. fermentum EcfT?

To improve the solubility and functionality of recombinant L. fermentum EcfT:

  • Optimize expression conditions: Adjust temperature, induction time, and inducer concentration to favor proper folding over rapid expression.

  • Use solubility-enhancing fusion partners: Consider fusion with solubility-enhancing tags such as MBP (maltose-binding protein) or SUMO.

  • Co-express with chaperones: Co-expression with appropriate chaperone proteins can assist proper folding.

  • Membrane-mimetic environments: For biochemical studies, use appropriate detergents or lipid nanodiscs to maintain native-like environment.

  • Expression level control: Use tunable promoters to prevent overwhelming the membrane protein insertion machinery.

  • Signal sequence optimization: Optimize signal sequences to improve membrane targeting.

  • Growth media optimization: Supplement growth media with components that support membrane protein production, such as specific lipids or membrane-stabilizing agents.

These strategies should be empirically tested as their effectiveness may vary depending on the specific properties of the recombinant EcfT construct and the L. fermentum strain used.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.