Recombinant Lactobacillus gasseri UPF0397 protein LGAS_1499 (LGAS_1499)

Shipped with Ice Packs
In Stock

Description

Key Features:

  • Expression System: E. coli BL21(DE3) .

  • Purity: >90% (verified by SDS-PAGE) .

  • Storage: Lyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0) .

Functional Insights

While the exact biological role of LGAS_1499 remains uncharacterized, genomic studies of L. gasseri ATCC 33323 suggest it encodes surface-associated proteins involved in mucosal adhesion and host-microbe interactions . Notably:

  • Structural Homology: LGAS_1499 shares conserved domains with mucus-binding proteins, which facilitate colonization in the gastrointestinal tract .

  • Anti-Inflammatory Potential: L. gasseri strains broadly suppress proinflammatory cytokines (e.g., TNF-α, IL-6) via ADAM17 inhibition , though direct evidence linking this mechanism to LGAS_1499 is pending.

Experimental Applications

The recombinant protein is primarily used for:

  • Immunoassays: ELISA development due to its antigenic properties .

  • Structural Studies: Homology modeling and substrate-binding analyses .

Research Gaps and Future Directions

  • Functional Annotation: No direct studies confirm LGAS_1499’s enzymatic or immunomodulatory activity.

  • Therapeutic Relevance: L. gasseri strains are engineered for probiotic delivery of functional proteins (e.g., anti-inflammatory factors) , but LGAS_1499’s utility in such systems remains unexplored.

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes; we will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs. Dry ice shipping is available upon request, incurring an additional charge. Please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting to -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
LGAS_1499; UPF0397 protein LGAS_1499
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-185
Protein Length
full length protein
Species
Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63)
Target Names
LGAS_1499
Target Protein Sequence
MNKQKGLSVKSVVAIGIGAAIYVILARFTSIPTGIPNTNIEIVYPFLALLATIYGPVVGF SVGFIGHALGDFLMYGQTWWSWVLATAVLGLIIGLYGMRLDLDNGVFTVKQMVGFNVVQI IANVISWLLIAPVGDILIYSEPQNKVFLQGATATITNSLSILILGTILLKAYAATKVKKG SLRKD
Uniprot No.

Target Background

Database Links
Protein Families
UPF0397 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage and handling conditions for recombinant LGAS_1499?

The recombinant protein should be stored as follows:

ConditionRecommendation
Long-term storage-20°C/-80°C, with aliquoting to avoid freeze-thaw cycles
Working storage4°C for up to one week
Storage bufferTris/PBS-based buffer with 6% Trehalose, pH 8.0
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mL
For extended storageAdd 5-50% glycerol (final concentration)

Prior to opening, the vial should be briefly centrifuged to ensure all content is at the bottom. Repeated freeze-thaw cycles should be strictly avoided as they can compromise protein stability and activity .

How can researchers verify the identity and purity of recombinant LGAS_1499?

Standard verification should include:

  • SDS-PAGE analysis to confirm >90% purity and expected molecular weight

  • Western blot using anti-His antibodies to detect the N-terminal His-tag

  • Mass spectrometry for precise molecular weight determination

  • Peptide mapping via enzymatic digestion followed by LC-MS/MS

  • N-terminal sequencing to confirm the first 10-15 amino acids

For advanced verification, circular dichroism spectroscopy may be employed to assess secondary structure integrity .

What experimental controls should be included when working with recombinant LGAS_1499?

A robust experimental design should incorporate:

  • Negative controls:

    • Buffer-only treatments to account for vehicle effects

    • Irrelevant recombinant protein with similar size and tag

    • Heat-denatured LGAS_1499 to distinguish structure-dependent effects

  • Positive controls:

    • Known Lactobacillus gasseri proteins with established functions

    • Well-characterized proteins from the UPF0397 family from other species

  • Concentration-dependent response assessments using multiple protein concentrations ranging from 0.1-10 μg/ml

These controls will help establish specificity and biological relevance while minimizing experimental artifacts. Statistical analysis should employ appropriate factorial or randomized block designs as outlined in experimental design literature .

How can researchers design experiments to investigate potential functions of LGAS_1499?

Given the limited functional characterization of UPF0397 family proteins, a multi-faceted approach is recommended:

  • Comparative genomics: Align LGAS_1499 with homologs from related bacteria to identify conserved domains.

  • Protein interaction studies:

    • Pull-down assays using His-tagged LGAS_1499 as bait

    • Yeast two-hybrid screening against L. gasseri proteome

    • Cross-linking experiments followed by mass spectrometry

  • Functional assays:

    • Membrane localization studies using fluorescently-tagged protein

    • Gene knockout/complementation in L. gasseri

    • Heterologous expression in model bacteria

  • Structural analysis:

    • X-ray crystallography or NMR spectroscopy

    • In silico structural prediction and molecular dynamics simulations

These approaches should be designed using factorial or Latin square experimental designs to efficiently explore multiple variables while minimizing required resources .

What statistical approaches are most appropriate for analyzing data from experiments with LGAS_1499?

The statistical approach should be tailored to the experimental design:

  • For comparative studies with multiple variables, factorial ANOVA is recommended:

    • Use two-way or three-way ANOVA for experiments comparing different protein concentrations, cell types, and/or time points

    • Apply repeated measures ANOVA for time-course experiments

    • Ensure sphericity assumptions are met or apply corrections (Greenhouse-Geisser or Huynh-Feldt)

  • For dose-response experiments:

    • Non-linear regression modeling with appropriate curve fitting

    • Calculation of EC50/IC50 values with 95% confidence intervals

  • For interaction studies:

    • Network analysis algorithms for large-scale interaction data

    • Appropriate statistical tests for co-localization measurements

Power analysis should be conducted prior to experimentation, with sample sizes sufficient to detect biologically meaningful effects (typically aiming for power ≥0.8) .

How might LGAS_1499 be relevant in studying L. gasseri as a vaccine vector?

Lactobacillus gasseri has demonstrated potential as an oral vaccine vector due to its GRAS status, natural colonization of human mucosal tissues, and ability to activate specific immune responses . LGAS_1499's potential role can be investigated through:

  • Comparative immunogenicity studies:

    • Wild-type L. gasseri vs. LGAS_1499 overexpression strains

    • Assessment of TLR activation profiles (particularly TLR2/6 and TLR2 homodimer)

    • Measurement of dendritic cell maturation markers (CD80, CD86, MHC-II)

  • Adjuvant potential evaluation:

    • Co-expression of LGAS_1499 with candidate vaccine antigens

    • Assessment of antibody titers and T-cell responses

    • Comparison with established adjuvants

  • Mucosal immune response characterization:

    • Analysis of B-cell population diversity in lamina propria

    • Assessment of regulatory T-cell (FoxP3+) percentages

    • Cytokine profiling (including IL-10 production)

These studies should employ split-plot or repeated measures designs when evaluating multiple parameters over time .

What approaches can be used to investigate LGAS_1499's potential interaction with host immune receptors?

Based on L. gasseri's known interaction with TLR2/6 and TLR2 homodimers , the following methodologies are recommended:

  • In vitro receptor binding studies:

    • Surface plasmon resonance (SPR) with purified TLRs

    • Cell-based reporter assays using HEK293 cells expressing individual TLRs

    • Competitive binding assays with known TLR ligands

  • Structural studies of receptor-ligand interactions:

    • Co-crystallization of LGAS_1499 with TLR ectodomains

    • Hydrogen-deuterium exchange mass spectrometry to map interaction surfaces

    • Molecular docking and simulation studies

  • Functional consequence assessment:

    • Cytokine profiling in human dendritic cells (including IL-10, IL-12, TNF-α)

    • Phenotypic maturation markers (CD80, CD86, MHC-II upregulation)

    • Signaling pathway activation (NF-κB, MAPK)

For in vivo validation, studies using TLR-knockout mice would provide definitive evidence of receptor specificity.

How can researchers address contradictory data when studying LGAS_1499's biological effects?

When faced with contradictory experimental results, consider:

  • Systematic variation sources:

    • Different recombinant protein preparations (expression systems, purification methods)

    • Variation in experimental conditions (temperature, pH, buffer composition)

    • Cell line or animal strain differences

  • Methodological approach to resolution:

    • Meta-analysis of multiple experimental datasets

    • Development of a factorial design specifically testing contradictory conditions

    • Independent replication in different laboratories

  • Statistical considerations:

    • Bayesian analysis to incorporate prior knowledge

    • Mixed-effects models to account for between-laboratory variation

    • Sensitivity analysis to identify influential observations or conditions

Importantly, seemingly contradictory results may reflect genuine biological complexity rather than experimental error. Consider whether LGAS_1499 might have context-dependent functions varying by cell type, physiological state, or presence of cofactors.

What strategies can be employed to genetically modify LGAS_1499 for functional studies?

Several approaches can be considered:

  • Domain-based modifications:

    • Truncation constructs to identify functional domains

    • Chimeric proteins replacing domains with homologs from related species

    • Point mutations targeting conserved residues

  • Fusion protein strategies:

    • N- or C-terminal reporter fusions (GFP, mCherry) for localization studies

    • Split-protein complementation constructs for interaction studies

    • Proximity-labeling fusions (BioID, APEX) to identify neighboring proteins

  • Expression control elements:

    • Inducible promoters for temporal control

    • Tissue-specific promoters for spatial control in animal models

    • Secretion signal sequences for extracellular targeting

When designing genetically modified variants, researchers should consider potential effects on protein folding, stability, and native function. Each modification should be validated through appropriate control experiments.

How might expanding the TLR activation profile of L. gasseri through genetic modification affect LGAS_1499 function?

Based on studies with flagellin-expressing L. gasseri , researchers should consider:

  • Interaction effects:

    • Potential synergistic or antagonistic effects between TLR2/6 activation (native) and additional TLR activation (e.g., TLR5 via flagellin)

    • Impact on downstream signaling pathway integration

    • Effects on cytokine balance (pro-inflammatory vs. regulatory)

  • Experimental approach:

    • Co-expression studies of LGAS_1499 with flagellin or other TLR ligands

    • Comparative dendritic cell activation assays

    • Analysis of mucosal immune cell populations, particularly regulatory T-cells and B-cell diversity in the lamina propria

  • Key measurements:

    • Cytokine production profile, especially IL-10 vs. pro-inflammatory cytokines

    • Dendritic cell maturation markers

    • In vivo colonization and persistence of modified strains

The significant decrease in FoxP3+ colonic lymphocytes observed with genetically modified L. gasseri suggests that TLR profile expansion may shift the immune response away from tolerance and toward activation, which could enhance vaccine vector efficacy.

What methods are most appropriate for analyzing LGAS_1499 expression and localization in L. gasseri?

Researchers should employ complementary approaches:

  • Protein expression quantification:

    • Western blotting with specific antibodies or anti-tag antibodies

    • Mass spectrometry-based targeted proteomics (SRM/MRM)

    • ELISA for secreted variants

  • Localization studies:

    • Immunofluorescence microscopy with specific antibodies

    • Subcellular fractionation followed by Western blotting

    • Electron microscopy with immunogold labeling

    • Live-cell imaging using fluorescent protein fusions

  • Expression dynamics:

    • qRT-PCR for transcriptional analysis

    • Ribosome profiling for translational efficiency

    • Pulse-chase labeling for protein turnover assessment

These methods should be applied systematically using factorial experimental designs to assess effects of growth conditions, physiological state, and genetic background on LGAS_1499 expression and localization .

How can researchers address solubility and stability issues with recombinant LGAS_1499?

Common challenges and solutions include:

  • Solubility problems:

    • Optimize buffer conditions (pH, ionic strength, additives)

    • Consider fusion tags known to enhance solubility (MBP, SUMO, thioredoxin)

    • Explore detergent formulations for this potentially membrane-associated protein

    • Test co-expression with chaperones or binding partners

  • Stability challenges:

    • Perform thermal shift assays to identify stabilizing buffer conditions

    • Add appropriate protease inhibitors to prevent degradation

    • Consider site-directed mutagenesis of oxidation-prone residues

    • Explore lyophilization with stabilizing excipients

  • Activity preservation:

    • Develop functional assays to monitor activity during storage

    • Aliquot to avoid freeze-thaw cycles

    • Store at -80°C for long-term preservation

    • Consider addition of 50% glycerol for freezer storage

For detailed troubleshooting, a systematic approach using Design of Experiments methodology would efficiently identify optimal conditions.

What quality control measures should be implemented when producing recombinant LGAS_1499 for research?

A comprehensive quality control program should include:

  • Identity verification:

    • Mass spectrometry confirmation of molecular weight

    • Western blot with anti-His antibodies

    • N-terminal sequencing of the first 10-15 amino acids

  • Purity assessment:

    • SDS-PAGE with densitometry (target: >90% purity)

    • Size-exclusion chromatography to detect aggregates

    • Endotoxin testing (LAL assay) for interference-free immunological studies

  • Functional validation:

    • Binding assays to known interaction partners

    • TLR activation assays if applicable

    • Secondary structure analysis by circular dichroism

Each batch should be assigned a unique identifier with complete documentation of production and quality control results to ensure experimental reproducibility.

How can researchers address inconsistent results across different lots of recombinant LGAS_1499?

To minimize and address lot-to-lot variability:

  • Preventive measures:

    • Standardize expression and purification protocols

    • Implement rigorous quality control metrics with defined acceptance criteria

    • Prepare large single lots when possible to minimize variability across experiments

  • Comparative analysis:

    • Side-by-side testing of new and reference lots

    • Development of reference standards with defined activity units

    • Normalization protocols based on protein quantity and activity

  • Experimental design considerations:

    • Include lot number as a blocking factor in randomized block design experiments

    • Use Latin square designs to control for multiple sources of variation

    • Implement mixed-effects statistical models to account for lot as a random effect

By systematically addressing variability sources, researchers can distinguish true biological effects from technical artifacts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.