Recombinant Lactobacillus helveticus ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Lactobacillus helveticus ATP synthase subunit b (atpF) is a component of the ATP synthase complex found in the bacterium Lactobacillus helveticus . ATP synthase, also known as F₀F₁-ATPase, is a vital enzyme that produces adenosine triphosphate (ATP), the primary energy currency of cells, by utilizing a proton motive force across the cell membrane . The subunit b (atpF) is a crucial part of the F₀ sector of the ATP synthase, which is embedded in the cell membrane and responsible for proton translocation .

Characteristics of Lactobacillus helveticus

Lactobacillus helveticus is a lactic acid bacterium (LAB) known for its thermophilic properties and is commonly used in the production of Swiss-type cheeses like Emmental and Gruyère . This bacterium contributes significantly to the flavor and texture development during cheese ripening through its proteolytic and peptidolytic activities . L. helveticus has high nutritional requirements, needing specific exogenous sources of carbon, nitrogen, nucleotides, and vitamins for optimal growth .

ATP Synthase and Subunit b (atpF) Function

ATP synthase harnesses the energy from a proton gradient to synthesize ATP from adenosine diphosphate (ADP) and inorganic phosphate . The F₀ sector, where subunit b resides, is a transmembrane component that channels protons across the membrane, driving the rotation of the c-ring. This rotation is then mechanically coupled to the F₁ sector, which catalyzes the synthesis of ATP . Subunit b is essential for the structural integrity and function of the F₀ sector, acting as a stator that stabilizes the complex and facilitates efficient proton translocation .

Recombinant Production and Applications

Recombinant Lactobacillus helveticus ATP synthase subunit b (atpF) is produced using recombinant DNA technology, where the gene encoding atpF is cloned and expressed in a host organism . This allows for the production of large quantities of the protein for research and industrial applications. One supplier, CUSABIO TECHNOLOGY LLC, offers this recombinant protein .

Potential applications:

  • ELISA Assays: Recombinant atpF can be used in enzyme-linked immunosorbent assays (ELISA) for detecting and quantifying antibodies against Lactobacillus helveticus .

  • Structural Studies: The availability of recombinant atpF facilitates structural studies to understand the precise mechanism of ATP synthesis and proton translocation .

  • Drug Discovery: ATP synthase is a potential target for developing new antibacterial drugs. Recombinant atpF can be used in screening assays to identify compounds that inhibit ATP synthase activity .

Protein Sequence and Properties

The amino acid sequence of the Lactobacillus helveticus ATP synthase subunit b (atpF) is available in protein databases such as UniProt (A8YUJ7) . The protein consists of 169 amino acids, with an N-terminal region that includes several hydrophobic residues, indicative of a transmembrane helix . Key properties of the recombinant protein include:

PropertyValue
SpeciesLactobacillus helveticus (strain DPC 4571)
UniProt IDA8YUJ7
Amino Acid Length169
Molecular Weight0
Tag InformationDetermined during the production process
Storage BufferTris-based buffer, 50% glycerol
StorageStore at -20℃; for extended storage, conserve at -20℃ or -80℃. Avoid repeated freezing and thawing

Role in Bacterial Metabolism and Proteolysis

In L. helveticus, ATP synthase activity is crucial for maintaining cellular energy levels, especially during growth in milk where the bacterium relies on proteolysis to obtain essential amino acids . The bacterium's proteolytic system includes cell envelope-associated proteinases and intracellular peptidases that degrade casein into smaller peptides and free amino acids . The energy generated by ATP synthase supports these metabolic processes, ensuring the bacterium's survival and growth in its environment .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
atpF; lhv_0808; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-169
Protein Length
full length protein
Species
Lactobacillus helveticus (strain DPC 4571)
Target Names
atpF
Target Protein Sequence
MTIQTLFAASHHIYLGNALWYLICFAILLLLIKHFAWGPVSDMMEKRRQKVINDLDSAAS DRKKAETLANEREAALKNSRQEATQILSDAKANAQKTGKEIVASANEDAAAIRKKANEEA AKAKSDALDSARDQVADISLAIAEKVIAKNLSAEDQKDLVDQFIKELDD
Uniprot No.

Target Background

Function
F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 domain, containing the extramembrane catalytic core, and the F0 domain, housing the membrane proton channel. These domains are linked by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation via a rotary mechanism involving the central stalk subunits. This protein is a component of the F0 channel and part of the peripheral stalk, connecting F1 and F0.
Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is ATP synthase subunit b (atpF) in Lactobacillus helveticus?

ATP synthase subunit b (atpF) is a critical component of the F0F1-ATP synthase complex in Lactobacillus helveticus. This protein functions as part of the membrane-embedded F0 sector of ATP synthase, which is responsible for proton translocation across the cellular membrane. In L. helveticus, atpF forms part of the stator that connects the F1 catalytic domain to the F0 proton channel domain. The protein plays an essential role in energy metabolism, particularly during the conversion between ATP synthesis and hydrolysis processes that are crucial for bacterial survival.

ATP synthase functionality in L. helveticus is particularly significant as studies have shown that energy metabolism pathways are altered when this bacterium utilizes different nitrogen sources, with downregulation of ATP catabolism and phosphorylation pathways observed when casein is present as the primary nitrogen source .

What expression systems are most effective for producing recombinant L. helveticus atpF?

Based on related research with similar proteins, E. coli expression systems have proven most effective for producing recombinant ATP synthase subunits from Lactobacillus species. For instance, recombinant full-length ATP synthase subunit b from the related species Lactobacillus fermentum has been successfully expressed in E. coli with an N-terminal His-tag .

For optimal expression of L. helveticus atpF, the following parameters should be considered:

ParameterRecommended ConditionRationale
Expression HostE. coli BL21(DE3)Lacks lon and ompT proteases; high-level expression
VectorpET seriesTight regulation, high expression levels
Induction0.1-0.5 mM IPTG at OD600 0.6-0.8Prevents formation of inclusion bodies
Temperature16-25°C post-inductionImproves protein folding
PurificationIMAC using His-tagHigh purity and yield
Storage BufferTris/PBS-based buffer, pH 8.0, 6% TrehaloseMaintains protein stability

How does the expression of atpF in L. helveticus change under different energy demands?

The expression of atpF and other ATP synthase components in L. helveticus exhibits significant variation depending on energy demands and nutrient availability. Transcriptome and proteome analyses have revealed that when L. helveticus shifts from utilizing free amino acids to casein as a nitrogen source, substantial changes occur in energy metabolism pathways.

Studies comparing L. helveticus CICC22171 cultured in media containing either 20 basic amino acids or casein have shown downregulation of genes involved in ATP catabolism, phosphorylation, and ATP hydrolysis-coupled proton transport in casein-containing media . This indicates that the bacterium modifies its energy production strategy when processing complex proteins.

The specific regulatory patterns for atpF expression include:

  • Downregulation during casein utilization, potentially to conserve energy as the bacterium invests resources in proteolysis

  • Possible coordination with changes in the expression of other F0F1-ATP synthase subunits

  • Integration with broader shifts in energy metabolism, including alterations in glycolysis and aerobic respiration pathways

These changes reflect L. helveticus's adaptation to different nitrogen sources and energy demands, with atpF regulation being part of a complex metabolic response.

What role does atpF play in the adaptation of L. helveticus to different environmental conditions?

The atpF subunit contributes significantly to L. helveticus's ability to adapt to various environmental conditions, particularly relating to substrate availability and energy requirements. Research indicates that L. helveticus modifies its ATP metabolism substantially when shifting between different nitrogen sources or growth phases.

When L. helveticus utilizes casein instead of free amino acids, it undergoes a comprehensive metabolic reorganization, including:

  • Upregulation of transcription and protein synthesis machinery

  • Enhanced proteolytic enzyme activity

  • Downregulation of glycolysis and ATP hydrolysis pathways

  • Modification of the aerobic respiratory chain components

Within this context, atpF and other ATP synthase components appear to be regulated as part of energy conservation strategies. The shift in ATP metabolism when L. helveticus grows on protein-rich media suggests that atpF expression may be coordinated with the bacterium's need to allocate resources between energy production and protein utilization.

Furthermore, as a facultative anaerobic prokaryote, L. helveticus must adapt its energy metabolism to oxygen availability, with aerobic respiratory chain components localized to the cell membrane and anaerobic respiration occurring in the cytoplasm . The regulation of atpF likely plays a role in this adaptation to varying oxygen levels.

How does the structure-function relationship of atpF affect ATP synthesis in L. helveticus?

The structure-function relationship of atpF in L. helveticus is critical for proper ATP synthase assembly and function. While specific structural data for L. helveticus atpF is limited, insights can be drawn from related Lactobacillus species and the conserved nature of ATP synthase across bacteria.

In Lactobacillus fermentum, ATP synthase subunit b (atpF) consists of 168 amino acids with a predominantly alpha-helical structure . This subunit acts as part of the peripheral stalk connecting the F1 and F0 domains of ATP synthase, providing structural stability during the rotational catalysis that drives ATP synthesis.

Key functional domains within atpF include:

  • N-terminal membrane-anchoring domain - typically hydrophobic and embedded in the membrane

  • Central connecting region - provides flexibility during conformational changes

  • C-terminal domain - interacts with the F1 sector and other stator components

Mutations or structural alterations in these domains can significantly impact ATP synthase function, with potential consequences for:

Understanding these structure-function relationships is crucial for interpreting how atpF contributes to L. helveticus's energy metabolism under different growth conditions and substrate availability scenarios.

What are the optimal conditions for purifying recombinant L. helveticus atpF?

Purification of recombinant L. helveticus atpF requires careful optimization to maintain protein integrity and function. Based on protocols established for similar proteins, the following multi-step purification approach is recommended:

Step 1: Initial Clarification

  • Harvest cells by centrifugation (6,000 × g, 15 min, 4°C)

  • Resuspend in lysis buffer (50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole, 1 mM PMSF)

  • Disrupt cells by sonication or high-pressure homogenization

  • Remove debris by centrifugation (20,000 × g, 30 min, 4°C)

Step 2: Immobilized Metal Affinity Chromatography (IMAC)

  • Load clarified lysate onto Ni-NTA column pre-equilibrated with binding buffer

  • Wash with buffer containing 20-40 mM imidazole

  • Elute with buffer containing 250-300 mM imidazole

Step 3: Size Exclusion Chromatography

  • Apply IMAC-purified protein to Superdex 75/200 column

  • Elute with storage buffer (50 mM Tris-HCl pH 8.0, 150 mM NaCl, 6% trehalose)

For long-term storage, the purified protein should be aliquoted and stored at -80°C with 50% glycerol as a cryoprotectant . Avoid repeated freeze-thaw cycles as they can significantly reduce protein activity.

What experimental approaches can be used to study interactions between atpF and other ATP synthase subunits?

Studying the interactions between atpF and other ATP synthase subunits in L. helveticus requires specialized techniques that can detect and characterize protein-protein interactions. The following methodologies are particularly useful:

Co-immunoprecipitation (Co-IP)

  • Utilizes antibodies against atpF or other subunits to pull down interaction complexes

  • Can be combined with mass spectrometry for identification of binding partners

  • Particularly useful for validating predicted interactions within the ATP synthase complex

Surface Plasmon Resonance (SPR)

  • Provides quantitative binding kinetics (ka, kd, and KD)

  • Allows real-time monitoring of protein-protein interactions

  • Can assess how mutations affect binding affinities between atpF and other subunits

Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS)

  • Identifies regions of atpF involved in subunit interactions

  • Provides structural information about conformational changes upon binding

  • Maps interaction interfaces with high resolution

Crosslinking Mass Spectrometry (XL-MS)

  • Creates covalent bonds between interacting proteins using chemical crosslinkers

  • Identifies specific residues involved in protein-protein interactions

  • Particularly useful for analyzing dynamic or transient interactions

Cryo-electron Microscopy (Cryo-EM)

  • Visualizes the entire ATP synthase complex with near-atomic resolution

  • Reveals the structural organization of atpF within the complex

  • Can be used to study conformational states during catalysis

These complementary approaches provide comprehensive insights into how atpF interacts with other subunits to maintain the structural integrity and functional capacity of the ATP synthase complex in L. helveticus.

How can transcriptomics and proteomics be integrated to study atpF regulation in L. helveticus?

Integrating transcriptomics and proteomics provides a powerful approach to study atpF regulation in L. helveticus under different conditions. This multi-omics strategy offers insights that cannot be obtained from either technique alone, as demonstrated in previous studies of L. helveticus metabolism .

Recommended Integrated Workflow:

  • Experimental Design

    • Compare L. helveticus grown under different conditions (e.g., varying nitrogen sources, oxygen levels, pH)

    • Include appropriate biological and technical replicates

    • Harvest samples at multiple time points to capture dynamic regulation

  • Transcriptomic Analysis

    • Perform RNA sequencing (RNA-seq) to quantify atpF mRNA expression

    • Use de novo transcriptome assembly for comprehensive coverage

    • Identify differentially expressed genes (DEGs) related to ATP metabolism

  • Proteomic Analysis

    • Apply isobaric tags for relative and absolute quantification (iTRAQ)

    • Include enrichment steps for membrane proteins to better capture ATP synthase components

    • Quantify atpF protein levels and post-translational modifications

  • Data Integration

    • Calculate correlation between mRNA and protein levels for atpF

    • Identify potential post-transcriptional regulatory mechanisms

    • Map atpF regulation within broader energy metabolism networks

Previous research with L. helveticus CICC22171 demonstrated that changes at the post-transcriptional level can only be elucidated by proteomics, making the integrated approach essential . When studying atpF specifically, this approach can reveal:

  • Discordance between transcription and translation that may indicate post-transcriptional regulation

  • Coordination of atpF expression with other ATP synthase subunits

  • Integration of atpF regulation with broader metabolic shifts during adaptation to different conditions

What techniques are most effective for assessing the functional impact of atpF mutations in L. helveticus?

Assessing the functional impact of atpF mutations in L. helveticus requires a combination of genetic, biochemical, and physiological approaches. The following techniques provide complementary insights into how mutations affect ATP synthase function:

Site-Directed Mutagenesis and Homologous Recombination

  • Create precise mutations in the atpF gene

  • Generate knockout and complementation strains

  • Establish structure-function relationships through systematic mutations

Growth and Metabolic Phenotyping

  • Compare growth rates under different conditions (carbon sources, oxygen levels)

  • Measure acidification rates as an indicator of energy metabolism

  • Analyze metabolite profiles using LC-MS or NMR to identify metabolic shifts

ATP Synthesis/Hydrolysis Assays

  • Measure ATP production using luciferase-based assays

  • Assess ATP hydrolysis through phosphate release assays

  • Compare enzyme kinetics between wild-type and mutant proteins

Membrane Potential and Proton Gradient Measurements

  • Use fluorescent probes (e.g., TMRM, JC-1) to quantify membrane potential

  • Measure intracellular pH with pH-sensitive fluorescent proteins

  • Assess proton-motive force disruption in atpF mutants

Protein Structure and Stability Analysis

  • Apply circular dichroism (CD) spectroscopy to assess secondary structure changes

  • Use differential scanning calorimetry (DSC) to measure thermal stability

  • Perform limited proteolysis to identify structural perturbations

These methodologies should be applied in a systematic manner, starting with in vitro characterization of purified recombinant proteins, followed by in vivo assessment of physiological impacts in L. helveticus.

How can recombinant L. helveticus atpF be utilized in structural biology studies?

Recombinant L. helveticus atpF offers significant opportunities for structural biology studies that can advance our understanding of ATP synthase function. Several cutting-edge approaches are particularly promising:

Cryo-Electron Microscopy (Cryo-EM)

  • Enables visualization of ATP synthase at near-atomic resolution

  • Particularly valuable for membrane proteins that are challenging for X-ray crystallography

  • Can capture different conformational states during the catalytic cycle

X-ray Crystallography

  • Provides high-resolution structures of atpF alone or in complex with other subunits

  • Requires production of highly pure, homogeneous, and stable protein preparations

  • May necessitate the use of crystallization chaperones or antibody fragments to facilitate crystal formation

Nuclear Magnetic Resonance (NMR) Spectroscopy

  • Offers insights into dynamic properties and conformational changes

  • Particularly useful for studying specific domains or fragments of atpF

  • Requires isotope labeling (15N, 13C) of recombinant protein

Molecular Dynamics (MD) Simulations

  • Integrates experimental structural data with computational approaches

  • Reveals dynamic properties not captured by static structural techniques

  • Predicts effects of mutations or environmental conditions on atpF structure and function

To maximize the success of these approaches, optimization of expression and purification protocols is critical. The recombinant L. helveticus atpF should be produced with careful attention to maintaining native-like structure, potentially including appropriate detergents or nanodiscs to stabilize the membrane-associated domains.

What is the relationship between atpF expression and the proteolytic activity of L. helveticus?

The relationship between atpF expression and proteolytic activity in L. helveticus represents an intriguing area of research at the intersection of energy metabolism and protein utilization. Integrated transcriptomics and proteomics studies have revealed complex interactions between these systems.

When L. helveticus shifts from utilizing free amino acids to casein as a nitrogen source, significant metabolic reprogramming occurs. This includes:

  • Downregulation of ATP catabolism, phosphorylation, and ATP hydrolysis-coupled proton transport pathways

  • Upregulation of proteolytic enzymes and transport systems for peptides and amino acids

  • Modification of glycolysis and respiratory chain components

These coordinated changes suggest that L. helveticus carefully balances energy production (involving ATP synthase, including atpF) with protein degradation and utilization. The downregulation of ATP metabolism pathways during casein utilization likely represents an energy conservation strategy while the bacterium invests resources in proteolysis.

Several specific connections between atpF and proteolytic systems deserve particular attention:

  • The ATP-binding cassette (ABC) transporter system, which is upregulated during casein utilization and requires ATP (potentially linked to ATP synthase activity)

  • The endopeptidase Clp complex, which is associated with protein hydrolysis and shows altered expression during protein utilization

  • The cell envelope proteinase (CEP) system, which is downregulated in Mn2+-associated forms during casein utilization

Understanding these relationships could lead to strategies for optimizing L. helveticus strains for specific applications in dairy fermentation and functional food production.

What are the most promising future research directions for studying L. helveticus atpF?

Research on L. helveticus atpF presents several exciting future directions that could significantly advance our understanding of bacterial energy metabolism and its relationship to important industrial applications:

Systems Biology Integration

  • Develop comprehensive models of how atpF regulation integrates with broader metabolic networks

  • Apply multi-omics approaches (genomics, transcriptomics, proteomics, metabolomics) to understand regulatory circuits

  • Investigate how atpF contributes to metabolic flexibility during environmental adaptation

Strain Engineering Applications

  • Modify atpF expression to optimize energy metabolism for specific industrial applications

  • Develop L. helveticus strains with enhanced proteolytic activity through ATP metabolism engineering

  • Create reporter systems based on atpF regulation to monitor cellular energy status

Structural Biology Advancements

  • Resolve high-resolution structures of the complete ATP synthase complex from L. helveticus

  • Compare structures across different Lactobacillus species to identify unique features

  • Investigate conformational changes during the catalytic cycle using time-resolved techniques

Functional Food Applications

  • Explore connections between energy metabolism (involving atpF) and bioactive peptide production

  • Investigate how modulation of ATP synthase activity affects the formation of health-promoting compounds

  • Develop strategies to enhance specific metabolic pathways through ATP metabolism engineering

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.