Recombinant Lactobacillus helveticus Energy-coupling factor transporter transmembrane protein EcfT (ecfT)

Shipped with Ice Packs
In Stock

Description

Functional Role in Energy-Coupling Factor (ECF) Transporters

ECF transporters are ATP-binding cassette (ABC) systems that import micronutrients (e.g., vitamins, metal ions) in bacteria. EcfT is the transmembrane component that forms a complex with EcfS (substrate-binding) and EcfA/A’ (ATPase) modules . Key functions include:

  • Structural stabilization of the transporter complex .

  • Substrate specificity modulation through transmembrane helix interactions .

  • Proton motive force coupling to drive nutrient uptake in nutrient-limited environments .

In L. helveticus, ECF transporters may support its robust proteolytic system by facilitating cofactor acquisition, enhancing casein hydrolysis, and promoting peptide metabolism .

Industrial Relevance

  • Cheese Production: L. helveticus strains are used in Swiss and Italian cheeses for casein hydrolysis. EcfT’s role in nutrient transport may optimize bacterial growth during fermentation .

  • Probiotic Development: Strains like L. helveticus R0052 utilize ECF transporters to enhance gut colonization and pathogen antagonism .

Research Findings

  • Proteomic Studies: Transcriptome analyses of L. helveticus under protein-rich conditions show upregulation of ABC transporters like EcfT, correlating with enhanced peptide uptake and metabolism .

  • Structural Biology: Recombinant EcfT is used to study transmembrane domain interactions in ECF transporters, aiding drug discovery against bacterial auxotrophy .

Challenges and Future Directions

  • Stability Issues: Repeated freeze-thaw cycles degrade the protein; glycerol stabilization is critical .

  • Functional Characterization: Further studies are needed to map EcfT’s role in L. helveticus stress responses and industrial fermentation efficiency .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, serving as a reference point.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and protein stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ecfT; lhv_0341; Energy-coupling factor transporter transmembrane protein EcfT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-277
Protein Length
full length protein
Species
Lactobacillus helveticus (strain DPC 4571)
Target Names
ecfT
Target Protein Sequence
MMGLRKMCRGSLMSKIIIGRYIPGDSLVYKMDPRGKLLITILFIWAIFLANNPITYAIIT FFCFLAIIATGLKARVFWNGVKPLIGLIFFTSLLQLFFMTGGHVFWHWWIFSISSYGVEN AIYIFIRFTLIILISTVMTVTTMPLEIADAMEWLLKPLKIFKVPVDEIALVISIALRFVP TLFDETLKIMNAQRSRGADFNDGGLIKRAKAIAPILVPLFIHSLETAIDLSTAMESRGYR GSAGRTKYRVLNWSKYDLISLAYFILLVGLLLIFRTH
Uniprot No.

Target Background

Function
The transmembrane (T) component of an energy-coupling factor (ECF) ABC-transporter complex. Unlike conventional ABC transporters, this ECF transporter provides the energy necessary for the transport of various substrates.
Database Links
Protein Families
Energy-coupling factor EcfT family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the role of EcfT protein in Energy-coupling factor transporters of L. helveticus?

EcfT serves as the energy-coupling transmembrane component that links ATP hydrolysis to substrate transport across the membrane. In ECF transporters, EcfT works in conjunction with two cytoplasmic ATPases (EcfA and EcfA') and a substrate-specific S-component to facilitate the uptake of essential micronutrients . Unlike classical ABC importers that utilize periplasmic substrate-binding proteins, ECF transporters rely on the membrane-embedded S-component for both substrate binding and translocation, with EcfT providing the energy-coupling mechanism that drives this process .

What structural features characterize the EcfT protein in bacterial ECF transporters?

While specific structural data for L. helveticus EcfT is limited in the search results, insights can be gained from studies of related ECF transporters. EcfT is a transmembrane protein that interacts with both the cytoplasmic ATPases (EcfA and EcfA') and the substrate-specific S-component. Based on structural studies of ECF transporters, EcfT likely contains multiple transmembrane helices that anchor the complex in the membrane and facilitate conformational changes during the transport cycle .

The topology of EcfT is designed to enable the unusual "toppling" mechanism that has been observed in ECF transporters, where the S-component rotates within the membrane to transport substrates across the lipid bilayer . This toppling mechanism represents a unique transport strategy among membrane transporters and requires specific structural features in the EcfT component to support this conformational change.

What expression systems are optimal for producing recombinant L. helveticus EcfT?

For the heterologous expression of membrane proteins like EcfT, several expression systems can be considered with varying advantages:

Expression SystemAdvantagesChallenges
E. coliHigh yield, genetic tractability, cost-effectivenessPotential for improper folding of Gram-positive bacterial proteins
Lactococcus lactisCloser phylogenetic relationship to L. helveticus, better membrane compatibilityLower expression yields compared to E. coli
Bacillus subtilisEfficient secretion, natural Gram-positive hostMore complex genetic manipulation
Cell-free systemsAvoids toxicity issues, direct access to reaction environmentMay require optimization for membrane protein integration

When expressing recombinant EcfT, it's essential to include appropriate affinity tags (His, FLAG, etc.) for purification while ensuring these modifications don't interfere with protein folding or function. Given the transmembrane nature of EcfT, expression systems must be optimized to facilitate proper membrane insertion. For structural studies similar to those conducted on other ECF transporters, researchers might consider co-expression with other components of the ECF module to maintain native protein-protein interactions and conformational stability .

What are the challenges in reconstituting functional ECF transporter complexes containing recombinant EcfT?

Reconstituting functional ECF transporter complexes presents several significant challenges:

  • Membrane protein solubilization: Identifying appropriate detergents that maintain EcfT structure and function during extraction from cell membranes is critical. Different detergents should be screened for optimal solubilization efficiency.

  • Complex assembly: EcfT must be correctly assembled with the EcfA, EcfA', and appropriate S-component to form a functional complex. This may require co-expression or careful reconstitution protocols.

  • Functional assessment: Developing assays to verify that the reconstituted complex maintains transport activity. This could involve measuring ATP hydrolysis coupled to substrate transport using radiolabeled substrates or fluorescent analogs.

  • Stability during purification: ECF transporters from different bacterial species have been successfully crystallized , suggesting that with appropriate stabilization strategies (lipid addition, specific buffer compositions), stable complexes containing L. helveticus EcfT could potentially be isolated.

A methodological approach would involve systematic screening of expression conditions, detergent types, and reconstitution protocols, followed by functional assays measuring both ATPase activity and substrate transport.

How can researchers measure the coupling between ATP hydrolysis and substrate transport in ECF systems?

To assess the coupling between ATP hydrolysis and substrate transport in ECF systems containing L. helveticus EcfT, researchers can employ several complementary approaches:

  • ATP hydrolysis assays: Measure ATP consumption using colorimetric assays (e.g., malachite green) or radioisotope methods with γ-³²P-ATP in the presence and absence of substrate.

  • Transport assays in reconstituted proteoliposomes:

    • Reconstitute purified ECF complexes into liposomes

    • Measure uptake of radiolabeled substrates (e.g., ³H-folate, if using a folate-specific S-component)

    • Establish ATP-dependence by comparing transport rates with and without ATP

  • Coupling ratio determination: Calculate the number of ATP molecules hydrolyzed per substrate molecule transported by simultaneously measuring ATP hydrolysis and substrate uptake.

  • Mutational analysis: Create mutations in key residues of EcfT predicted to be involved in energy coupling, then assess how these mutations affect both ATP hydrolysis and substrate transport rates.

Based on studies with other ECF transporters, the coupling mechanism likely involves conformational changes in EcfT that are transmitted to the S-component, enabling the characteristic toppling mechanism observed in ECF transporters . This toppling reorients the substrate-binding site from the extracellular to the cytoplasmic face of the membrane.

What methods can identify interaction partners of EcfT within the ECF complex?

Several techniques can be employed to characterize the interactions of EcfT with other components of the ECF transport system:

TechniqueApplicationAdvantagesLimitations
Co-immunoprecipitationIn vivo protein-protein interactionsDetects native complexesMay disrupt weak interactions
Crosslinking coupled with MSIdentification of interaction interfacesCaptures transient interactionsPotential for non-specific crosslinks
Surface plasmon resonanceBinding kinetics and affinityQuantitative binding parametersRequires purified components
FRET or BRETReal-time interaction dynamicsCan monitor interactions in living cellsRequires fluorescent/luminescent tagging
Bacterial two-hybridGenetic screening for interactorsCan identify novel partnersMay yield false positives/negatives

ECF transporters have a defined architecture involving specific interactions between EcfT, the ATPase subunits (EcfA and EcfA'), and the S-component . For example, crystal structures of ECF transporters have revealed how the ECF module (EcfAA'T) stabilizes the toppled state of the S-component and affects substrate binding . Similar approaches could be applied to study the specific interactions involving L. helveticus EcfT.

What structural analysis techniques are most suitable for characterizing EcfT topology and conformation?

Several complementary techniques can be applied to determine the topology and conformational states of L. helveticus EcfT:

  • Cryo-electron microscopy (cryo-EM):

    • Particularly valuable for membrane proteins like EcfT

    • Can capture different conformational states

    • Has been successfully applied to other ECF transporters

    • Does not require crystallization

  • X-ray crystallography:

    • Provides high-resolution structures

    • Has been used successfully for ECF transporters from other organisms

    • Requires stable, homogeneous protein preparations

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Maps solvent-accessible regions

    • Identifies conformational changes during transport cycle

    • Less dependent on obtaining crystals

  • Site-directed spin labeling with EPR spectroscopy:

    • Monitors distances between specific residues

    • Useful for tracking conformational changes

    • Can work with relatively small amounts of protein

  • Cysteine accessibility scanning:

    • Determines membrane topology

    • Identifies water-accessible residues

    • Helps map transmembrane segments

Crystal structures of ECF transporters have revealed the toppling mechanism of the S-component and how it interacts with the ECF module . Similar approaches could elucidate the specific structural features of L. helveticus EcfT and its role in facilitating this unique transport mechanism.

How do mutations in conserved EcfT domains affect transporter function?

Systematic mutational analysis of conserved domains in EcfT can provide valuable insights into structure-function relationships. Based on knowledge of ECF transporters, key regions to target would include:

  • ATPase interaction domains: Mutations in regions that interact with EcfA/EcfA' would likely disrupt energy coupling.

  • S-component interaction interface: Mutations here would affect the ability of EcfT to stabilize the toppled conformation of the S-component, which is crucial for substrate translocation .

  • Transmembrane helices: Alterations in transmembrane regions might affect conformational changes required during the transport cycle.

  • Coupling helices: These typically connect transmembrane segments and transmit conformational changes from the ATPase domains to the transport machinery.

A methodological approach would involve:

  • Sequence alignment to identify conserved residues across ECF transporters

  • Creation of site-directed mutants at these positions

  • Functional assays measuring both ATP hydrolysis and substrate transport

  • Binding studies to assess complex formation with partner proteins

This approach has been valuable in understanding the mechanism of other ECF transporters, revealing how the ECF module interaction with the S-component affects substrate binding and release .

What genetic modification approaches work best for L. helveticus ecfT gene?

Engineering the ecfT gene in L. helveticus requires consideration of several factors specific to this organism:

  • Vector selection: Shuttle vectors that function in both E. coli and Lactobacillus species are preferable for cloning efficiency.

  • Transformation methods:

    • Electroporation is generally most effective for L. helveticus

    • Optimization of cell wall weakening treatments may enhance transformation efficiency

    • Protocol adjustments for the specific strain being used are essential

  • Selection markers:

    • Antibiotic resistance genes appropriate for L. helveticus (erythromycin, chloramphenicol)

    • Consideration of food-grade selection systems for potential probiotic applications

  • Promoter selection:

    • Native L. helveticus promoters for physiological expression levels

    • Inducible promoters for controlled expression

    • Strong constitutive promoters for overexpression

  • Gene editing approaches:

    • Homologous recombination for gene replacements

    • CRISPR-Cas9 systems adapted for Lactobacillus

    • Single-crossover integration for gene disruptions

How can CRISPR-Cas systems be optimized for editing the ecfT gene in L. helveticus?

CRISPR-Cas gene editing in L. helveticus requires optimization specific to this organism:

ParameterOptimization ApproachConsiderations
Cas9 expressionCodon optimization for L. helveticusExpression level, toxicity management
sgRNA designTarget sequence selection with minimal off-targetsPAM availability in GC-rich regions
Delivery methodTemperature-sensitive vectors, inducible systemsTransformation efficiency
Repair templateHomology arm length optimizationRecombination efficiency
Selection strategyCounterselection methods, FACSIdentifying successful edits
Off-target analysisWhole genome sequencingConfirming specificity

For editing ecfT specifically:

  • Design guide RNAs targeting non-essential regions of ecfT

  • Create repair templates with desired mutations flanked by homology arms

  • Optimize transformation conditions for L. helveticus

  • Screen transformants for successful edits

  • Confirm phenotypic effects through transport assays

The genetic tractability of L. helveticus may vary between strains, with some strains like ATCC® 15009™ being more widely used in research . Considerations for the probiotic potential of engineered strains should also be addressed, particularly if modifications might impact health-promoting properties .

How does L. helveticus EcfT differ from EcfT proteins in other bacterial species?

While specific comparative data for L. helveticus EcfT is limited in the search results, we can infer potential differences based on general principles of ECF transporters and bacterial evolution:

  • Substrate specificity adaptation: L. helveticus EcfT likely evolved to optimize uptake of specific micronutrients essential in the ecological niches this bacterium inhabits, such as dairy environments.

  • Energy coupling efficiency: As a probiotic organism with specific metabolic requirements , L. helveticus may have evolved unique coupling mechanisms between ATP hydrolysis and substrate transport.

  • Interaction specificity: The interfaces between EcfT and various S-components may differ in L. helveticus compared to other bacteria, reflecting the specific subset of micronutrients prioritized by this organism.

  • Structural adaptations: Comparative sequence analysis would likely reveal conserved domains involved in core functions (ATP coupling, conformational changes) alongside more variable regions that might confer species-specific advantages.

Crystal structures of ECF transporters from organisms like Lactobacillus delbrueckii have revealed the toppling mechanism of S-components and how they interact with the ECF module . Similar structural studies with L. helveticus EcfT would allow direct comparison and identification of species-specific features.

What evolutionary relationships exist between ECF transporters across different bacterial species?

ECF transporters represent an ancient family of transporters that has diversified across bacterial lineages. Several evolutionary patterns are noteworthy:

  • Modular evolution: The ECF module (EcfAA'T) can associate with different S-components, allowing for evolutionary mix-and-match to acquire various substrates .

  • Two distinct groups:

    • Group I: Dedicated ECF modules associated with specific S-components

    • Group II: Shared ECF modules that can interact with multiple S-components

  • Conservation of mechanism: Despite sequence divergence, the unique toppling mechanism appears conserved across ECF transporters , suggesting fundamental constraints on the transport mechanism.

  • Taxonomic distribution: ECF transporters are exclusively found in prokaryotes , with particular importance in organisms that inhabit nutrient-limited environments.

L. helveticus, as a member of the Lactobacillus genus, likely possesses ECF transporters that reflect its evolutionary history and adaptation to dairy environments. Comparative genomic analysis could reveal how L. helveticus ECF transporters have specialized compared to those in related species like L. delbrueckii or other lactic acid bacteria.

How might recombinant EcfT contribute to understanding probiotic mechanisms of L. helveticus?

L. helveticus has established probiotic properties , and understanding the role of EcfT in its physiology could provide insights into these beneficial effects:

  • Micronutrient acquisition in the gut: ECF transporters may enable L. helveticus to compete effectively for limited micronutrients in the intestinal environment, contributing to its persistence and probiotic effects.

  • Metabolic capabilities: The specific substrates transported by L. helveticus ECF systems could influence its metabolic outputs and associated health benefits. For example, vitamin uptake could affect the synthesis of bioactive compounds.

  • Stress resistance: Efficient micronutrient acquisition via ECF transporters might enhance survival during gastrointestinal transit, a key factor in probiotic efficacy .

  • Host interaction potential: Understanding EcfT's role in bacterial physiology might reveal how L. helveticus adapts to the host environment, which is relevant to its ability to influence intestinal epithelial barrier function and other probiotic mechanisms.

Recombinant EcfT could be used to develop reporter systems to monitor nutrient availability in vivo, providing new insights into how L. helveticus functions within the gut microbiome.

What emerging technologies could advance our understanding of EcfT dynamics in vivo?

Several cutting-edge approaches show promise for elucidating EcfT function in its native context:

  • Single-molecule tracking in live cells:

    • Fluorescent protein fusions with EcfT

    • Super-resolution microscopy to track movement and localization

    • Correlation with cellular metabolism and transport activity

  • In vivo structural biology:

    • Cryo-electron tomography of flash-frozen cells

    • In-cell NMR to detect conformational changes in native membrane

    • Mass spectrometry-based crosslinking in living bacteria

  • Biosensor development:

    • FRET-based sensors to detect substrate binding and transport

    • Real-time monitoring of transport kinetics in living cells

    • Correlation with physiological states

  • Systems biology integration:

    • Multi-omics approaches correlating EcfT function with metabolomics

    • Mathematical modeling of nutrient uptake networks

    • Machine learning to identify patterns in complex datasets

These approaches could reveal how L. helveticus ECF transporters function dynamically in changing environments such as the gastrointestinal tract, potentially uncovering new links between micronutrient transport and probiotic effects .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.