Recombinant Lactobacillus johnsonii ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Lactobacillus johnsonii ATP Synthase Subunit b (atpF)

Recombinant Lactobacillus johnsonii ATP synthase subunit b (atpF) refers to a genetically engineered form of the AtpF protein, which is a subunit of the ATP synthase enzyme found in the bacterium Lactobacillus johnsonii . ATP synthase is an essential enzyme that produces adenosine triphosphate (ATP), the primary energy currency of cells . The "recombinant" aspect indicates that the gene encoding the AtpF subunit has been isolated, modified, and then expressed in a host organism, such as E. coli, to produce large quantities of the protein .

Characteristics

CharacteristicDescription
OriginLactobacillus johnsonii
ProteinATP synthase subunit b (AtpF)
TypeRecombinant protein
Expression HostE. coli
TagN-terminal His tag
Purity>90% (as indicated for similar products)
Molecular WeightApproximately 18 kDa (based on amino acid sequence and similar proteins)
Amino Acid Sequence1-166aa (Full Length)
Gene InformationEncoded by the atpF gene

Production and Structure

The recombinant AtpF subunit is produced by cloning the atpF gene from Lactobacillus johnsonii into an expression vector, which is then introduced into E. coli . The E. coli cells are cultured to express the protein, and the recombinant AtpF subunit is then purified using affinity chromatography, often utilizing a His tag that is fused to the N-terminus of the protein .

Function and Biological Role

The ATP synthase enzyme is crucial for energy production in bacteria, catalyzing the synthesis of ATP from adenosine diphosphate (ADP) and inorganic phosphate using the proton motive force generated across the cell membrane . Subunit b (AtpF) is a critical component of the F0 sector of the ATP synthase, which is embedded in the membrane and responsible for proton translocation.

Potential Applications

  • Antimicrobials Lactobacillus produces diverse metabolites, such as peptides, that have antimicrobial properties .

  • Functional Foods: Fermenting food with Lactobacillus enhances the food's qualities, and may lead to the development of functional foods .

Research and Studies

Lactobacillus johnsonii is a probiotic bacterium with several beneficial effects, including inhibiting pathogenic bacteria and improving antioxidant activity . Studies have explored the genetic and metabolic characteristics of Lactobacillus johnsonii strains to understand their probiotic properties and mechanisms of action . Recombinant enzymes from Lactobacillus johnsonii have demonstrated anti-giardial activity, suggesting potential therapeutic applications .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
atpF; LJ_0936; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-166
Protein Length
full length protein
Species
Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Target Names
atpF
Target Protein Sequence
MQFMFAALKLELGDTLYYLLIFAALLLLVKHFAWGPVTKMMEERRQKVISDLDQAESDRK KAELLANQREAALKDSKQEATQILSTAKSNAEKTKNNIISQADQEAAAIRKRASEDAAQA KTDALNEARDQVADISVAIAEKVISKNLSAADQKDLVDQFIKGLND
Uniprot No.

Target Background

Function
F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the extramembraneous catalytic F1 domain and the membrane-bound proton channel F0 domain, connected by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits.
Database Links

KEGG: ljo:LJ_0936

STRING: 257314.LJ0936

Protein Families
ATPase B chain family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.