Recombinant Lactobacillus johnsonii Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery timelines.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
lspA; LJ_1187; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-154
Protein Length
full length protein
Species
Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Target Names
lspA
Target Protein Sequence
MSKAKQALYLIVSLLVIIADQLLKNYIVTNFKIGDEKTIIPGVLSFTYLQNDGAAWNIFS GQMILFYLISIAAIAVVIYYLFNPKYKNGLFDTGLALVLGGIIGNFIDRLHLKYVIDMLQ LDFIQFNIFNIADSAITVGIILVFIYLIFISEKD
Uniprot No.

Target Background

Function
This protein is a specific catalyst for the removal of signal peptides from prolipoproteins.
Database Links

KEGG: ljo:LJ_1187

STRING: 257314.LJ1187

Protein Families
Peptidase A8 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Lactobacillus johnsonii and why is it significant in microbiology research?

Lactobacillus johnsonii is a Gram-positive, homofermentative, non-spore-forming rod-shaped host-adapted bacterium that primarily produces lactic acid from sugar metabolism. It has been isolated from the vaginal and gastrointestinal tracts of various vertebrate hosts including humans, rodents, swine, and poultry . L. johnsonii is particularly interesting in research due to its:

  • Commensal relationship with host organisms

  • Potential health-promoting properties

  • Ability to antagonize pathogenic microorganisms

  • Immunomodulatory functions

  • Capacity to enhance epithelial barrier function

  • Potential to reduce chronic inflammation

  • Role in modulating metabolic disorders

These properties make L. johnsonii an important model organism for studying host-microbe interactions and a promising candidate for probiotic applications in both human and veterinary medicine .

What is lipoprotein signal peptidase (lspA) and what role does it play in bacterial physiology?

Lipoprotein signal peptidase (lspA), also known as type II signal peptidase (SPase II), is a critical enzyme involved in bacterial lipoprotein processing. Its primary functions include:

  • Cleaving the signal peptide from prolipoproteins after they have been modified by prolipoprotein diacylglyceryl transferase (Lgt)

  • Facilitating the final maturation steps of bacterial lipoproteins

  • Contributing to proper localization of lipoproteins to cell membranes

Research has demonstrated that lspA is essential for intracellular growth and virulence in many bacterial species . In Rickettsia species, and by extension potentially in other bacteria like L. johnsonii, lspA shows differential expression patterns during various stages of bacterial growth within host cells, suggesting its activity is regulated according to the bacteria's life cycle and environmental conditions .

How do researchers distinguish between lipoprotein and non-lipoprotein secretion pathways in L. johnsonii?

Distinguishing between lipoprotein and non-lipoprotein secretion pathways requires understanding the different processing enzymes involved:

  • Lipoprotein pathway: Involves Lgt (prolipoprotein transferase) and LspA (type II signal peptidase)

  • Non-lipoprotein pathway: Primarily utilizes LepB (type I signal peptidase)

Researchers can differentiate these pathways through:

  • Transcriptional analysis: Monitoring expression patterns of lspA and lgt (lipoprotein pathway) versus lepB (non-lipoprotein pathway)

  • Sequence analysis: Identifying lipoprotein signal sequences (lipobox motif) in target proteins

  • In silico prediction: Computational tools can predict whether proteins are likely to be lipoproteins

  • Inhibitor studies: Using globomycin (specific inhibitor of LspA) to selectively block lipoprotein processing

Based on studies in related bacterial systems, lepB typically shows higher expression levels than lspA and lgt, indicating that non-lipoprotein secretion may be the predominant pathway for protein secretion. For example, in Rickettsia typhi, out of 89 predicted secretory proteins, only 14 were identified as lipoproteins .

What conserved domains and residues characterize functional lspA proteins?

Functional lspA proteins across bacterial species contain several highly conserved domains and residues essential for enzymatic activity:

Domain/ResidueFunctionConservation Level
Aspartic acid residuesCatalytic activityHighly conserved
Transmembrane domainsMembrane anchoringModerately conserved
N-terminal regionSubstrate recognitionVariable
C-terminal regionStructural stabilityModerately conserved

These conserved elements can be identified through sequence alignment of lspA proteins from different bacterial species. The preservation of these essential residues and domains provides strong evidence for the functional role of a putative lspA gene in L. johnsonii . Mutations in these conserved regions typically result in loss of enzymatic function, making them valuable targets for structure-function studies.

How is the expression of lspA regulated during different growth phases of bacteria?

The expression of lspA appears to be dynamically regulated throughout the bacterial life cycle. Studies in Rickettsia typhi reveal a distinct pattern that may have parallels in L. johnsonii:

  • Pre-infection phase: High expression levels of lspA, lgt, and lepB, suggesting metabolically active bacteria are better equipped for host cell invasion

  • Early infection (0-8h): Decreased expression as bacteria adapt to intracellular environment

  • Exponential growth phase (after 8h): Increasing expression, reaching peak levels around 48h post-infection

  • Late/lytic phase (120h): Decreased expression as host cells begin to lyse

This pattern indicates that lipoprotein processing is particularly important during specific phases of the bacterial life cycle, especially during the initial infection process and during active replication. The similar expression patterns observed for lspA and lgt suggest coordinated regulation of the lipoprotein processing pathway.

What approaches are recommended for cloning and expressing recombinant lspA from L. johnsonii?

For successful cloning and expression of recombinant lspA from L. johnsonii, researchers should consider the following methodological approach:

  • Gene identification and isolation:

    • Perform genomic DNA extraction from L. johnsonii culture

    • Design primers based on conserved regions of lspA sequences

    • Amplify the target gene using high-fidelity PCR

  • Expression vector selection:

    • Choose appropriate vectors based on research goals:

      • pNZ8148 for expression in other lactic acid bacteria

      • pET series for high-level expression in E. coli

      • pBAD for regulated expression with arabinose induction

  • Optimization strategies:

    • Codon optimization for the host expression system

    • Addition of affinity tags (His, FLAG) for purification

    • Inclusion of native promoter elements for physiological expression levels

    • Consider using inducible promoters for controlled expression

  • Verification of functional activity:

    • Complementation assays in temperature-sensitive E. coli mutants (similar to those used for R. typhi lspA)

    • Globomycin resistance tests to confirm SPase II activity

    • Western blot analysis of processed versus unprocessed lipoproteins

The choice between heterologous expression (in E. coli) versus homologous expression (in Lactobacillus) depends on research objectives. E. coli systems typically provide higher protein yields but may not replicate native post-translational modifications.

How can researchers validate the functionality of recombinant L. johnsonii lspA?

Validating the functionality of recombinant lspA requires multiple complementary approaches:

  • Genetic complementation:

    • Transform temperature-sensitive E. coli lspA mutants (e.g., strain Y815) with the recombinant L. johnsonii lspA

    • Assess growth restoration at non-permissive temperatures

  • Biochemical assays:

    • Measure cleavage of synthetic lipoprotein substrates

    • Assess processing of known lipoproteins using western blot analysis

    • Monitor accumulation of prolipoprotein precursors in the presence/absence of functional lspA

  • Antimicrobial resistance tests:

    • Determine if recombinant lspA confers increased globomycin resistance

    • Compare minimum inhibitory concentration (MIC) values between strains expressing native versus recombinant lspA

  • Transcriptional analysis:

    • Use real-time quantitative RT-PCR to monitor expression patterns

    • Compare with expression patterns of other lipoprotein processing genes (lgt)

    • Correlate expression levels with bacterial growth phases

A comprehensive validation approach should include both in vitro and in vivo assays to fully characterize the functionality of the recombinant protein.

What are the methodological challenges in studying lspA expression dynamics in L. johnsonii?

Researchers face several methodological challenges when investigating lspA expression dynamics:

  • RNA isolation and quality:

    • Bacterial cell wall structure can complicate efficient RNA extraction

    • RNase contamination can degrade samples

    • Solution: Optimize RNA extraction protocols specifically for Gram-positive bacteria

  • Growth conditions standardization:

    • Variable growth rates under different conditions

    • Microaerophilic nature of L. johnsonii requires specialized culture conditions

    • Solution: Develop standardized growth protocols and reporting metrics

  • Temporal resolution:

    • Capturing rapid changes in gene expression requires precise timing

    • Solution: Implement time-course studies with appropriate sampling intervals

  • Intracellular expression analysis:

    • Studying L. johnsonii within host cells requires separation of bacterial and host RNA

    • Solution: Use species-specific primers and bacterial RNA enrichment techniques

  • Primer design considerations:

    • Sequence variations between strains can affect primer binding

    • Solution: Target highly conserved regions or design strain-specific primers

  • Reference gene selection for qRT-PCR:

    • Traditional reference genes may not maintain stable expression under all conditions

    • Solution: Validate multiple reference genes under experimental conditions

When studying lspA expression dynamics, researchers should implement two-step real-time qRT-PCR with appropriate reference genes and compare expression patterns with related genes like lgt and lepB to establish pathway-level dynamics .

How does modification of lspA affect L. johnsonii colonization and probiotic properties?

Modification of lspA in L. johnsonii can significantly impact its colonization ability and probiotic functions through several mechanisms:

  • Effects on lipoprotein processing:

    • Altered or deficient lspA affects maturation of surface lipoproteins

    • Improperly processed lipoproteins may not localize correctly

    • Changes in surface protein composition can alter:

      • Adhesion properties to host tissues

      • Biofilm formation capacity

      • Resistance to environmental stresses

  • Immunomodulatory effects:

    • Lipoproteins are important microbe-associated molecular patterns (MAMPs)

    • Changes in lipoprotein presentation can alter host immune recognition

    • May affect balance of pro- and anti-inflammatory responses

  • Colonization dynamics:

    • Modifications that enhance lspA activity may improve adhesion capabilities

    • Decreased lspA function typically reduces colonization efficiency

    • Strain-specific variations in colonization patterns may emerge

  • Competitive advantage:

    • Optimized lspA function could enhance competitive exclusion of pathogens

    • May improve production of antimicrobial compounds

    • Could enhance persistence in GI or vaginal environments

The specific effects depend on whether modifications enhance or diminish lspA activity. Engineering approaches might include promoter modifications to increase expression, codon optimization, or site-directed mutagenesis of key residues to alter substrate specificity or catalytic efficiency.

What experimental design is recommended for studying lspA-dependent lipoprotein functions in L. johnsonii?

A comprehensive experimental design for studying lspA-dependent lipoprotein functions should include:

  • Genetic manipulation approaches:

    • CRISPR-Cas9 gene editing for precise genomic modifications

    • Conditional expression systems to control lspA levels

    • Site-directed mutagenesis of catalytic residues to create enzymatically inactive variants

    • Overexpression constructs to assess effects of enhanced lspA activity

  • Proteomic identification of lspA substrates:

    • Comparative proteomics between wild-type and lspA-modified strains

    • Pulse-chase experiments to track lipoprotein maturation

    • Lipid-specific labeling techniques to identify lipoproteins

  • Functional characterization studies:

    • Adhesion assays to epithelial cell lines

    • Growth and survival under various stress conditions

    • Co-culture experiments with pathogens to assess antagonistic properties

    • Immunomodulation assays using dendritic cells or macrophages

  • In vivo validation:

    • Animal colonization models (e.g., germ-free mice)

    • Assessment of inflammatory markers in colonized tissues

    • Competition assays between wild-type and lspA-modified strains

  • Data analysis framework:

    • Multi-omics integration (transcriptomics, proteomics, metabolomics)

    • Statistical methods for time-series data

    • Machine learning approaches to identify patterns in complex datasets

This experimental framework allows for comprehensive characterization of how lspA-dependent lipoprotein processing contributes to L. johnsonii's probiotic properties and host interactions.

How can engineered L. johnsonii expressing modified lspA be utilized in therapeutic applications?

Engineered L. johnsonii strains with modified lspA could serve as platforms for various therapeutic applications:

  • Enhanced pathogen antagonism:

    • Optimized processing of antimicrobial lipoproteins

    • Improved competitive exclusion mechanisms

    • Specific targeting of pathogens like Helicobacter pylori

  • Immunomodulatory therapeutics:

    • Engineering strains that process immunomodulatory lipoproteins more efficiently

    • Development of strains with targeted anti-inflammatory properties

    • Potential applications in inflammatory bowel disease or vaginal dysbiosis

  • Delivery vehicles for heterologous proteins:

    • Using the lipoprotein processing machinery to anchor therapeutic proteins to the bacterial surface

    • Example application: L. johnsonii expressing bovine GM-CSF for treatment of endometritis

    • Development of multivalent vaccine platforms

  • Biofilm modification:

    • Engineered strains that modulate oral biofilms to prevent periodontitis

    • Modification of vaginal microbiome to prevent dysbiosis

  • Diagnostic tools:

    • Reporter systems based on lipoprotein processing

    • Biosensors for detecting specific environmental conditions

The development of such applications requires careful consideration of strain stability, safety assessment, validation of therapeutic efficacy, and optimization of delivery methods. A comparison of different engineering approaches is presented in the table below:

Engineering ApproachAdvantagesLimitationsPotential Applications
lspA overexpressionEnhanced processing of all lipoproteinsMay cause metabolic burdenGeneral enhancement of probiotic properties
Targeted modification of lspA substrate specificitySelective processing of specific lipoproteinsComplex protein engineering requiredTailored therapeutic applications
Co-expression of lspA with therapeutic lipoproteinsSynchronized expression of enzyme and substrateRequires careful regulationDelivery of therapeutic proteins
Inducible lspA expressionControlled timing of lipoprotein processingAdditional regulatory elements neededCondition-specific therapeutic responses

What real-time qRT-PCR protocols are recommended for studying lspA expression in L. johnsonii?

For robust analysis of lspA expression in L. johnsonii, researchers should implement the following qRT-PCR methodology:

  • RNA extraction and quality control:

    • Use specialized kits designed for Gram-positive bacteria

    • Include enzymatic cell wall digestion step (lysozyme, mutanolysin)

    • Verify RNA integrity (RIN > 8.0) using bioanalyzer

    • DNase treatment to eliminate genomic DNA contamination

  • cDNA synthesis:

    • Employ two-step RT-PCR protocol for maximum sensitivity

    • Use random hexamers combined with oligo-dT primers

    • Include no-RT controls to detect genomic DNA contamination

  • Primer design considerations:

    • Target amplicon size: 80-150 bp for optimal amplification efficiency

    • Primer melting temperature: 58-62°C

    • GC content: 40-60%

    • Validate specificity using in silico PCR and experimental validation

    • Example primers based on conserved regions:

      • Forward: 5'-TGCTGGTCATCGCTACTGCT-3'

      • Reverse: 5'-AGCCAAGGTCGTGATGAACT-3'

  • Reference gene selection:

    • Validate multiple reference genes under experimental conditions

    • Recommended candidates: 16S rRNA, recA, gyrB, rpoB

    • Use at least 3 reference genes for normalization

  • Data analysis:

    • Calculate relative expression using 2^(-ΔΔCt) method

    • Apply appropriate statistical tests (ANOVA with post-hoc tests)

    • Present data normalized to both time point and reference sample

This approach has been successfully used for monitoring expression patterns of genes involved in lipoprotein processing in bacteria across different growth phases .

What expression systems are most effective for producing recombinant L. johnsonii lspA protein?

The selection of an appropriate expression system for recombinant L. johnsonii lspA depends on the intended application:

  • E. coli expression systems:

    • pET system (T7 promoter): High-level expression for biochemical studies

    • pBAD system (arabinose-inducible): Tightly controlled expression

    • pCold system: Enhanced solubility for membrane proteins

    • Advantages: High yield, well-established protocols

    • Limitations: Potential folding issues with membrane proteins, lack of specific post-translational modifications

  • Lactobacillus expression systems:

    • pSIP system: Inducible expression in Lactobacillus

    • NICE system: Nisin-controlled expression

    • Advantages: Native-like processing, suitable for in vivo studies

    • Limitations: Lower expression levels, more complex genetic manipulation

  • Expression optimization strategies:

    • Codon optimization for the host organism

    • Addition of solubility tags (MBP, SUMO, TrxA)

    • Fusion with secretion signals for extracellular production

    • Lower induction temperatures (16-25°C) for membrane proteins

  • Purification approaches:

    • Detergent solubilization for membrane-bound lspA

    • Immobilized metal affinity chromatography (IMAC) with His-tagged constructs

    • Size exclusion chromatography for final polishing

For functional studies, using the E. coli system has been demonstrated effective, as recombinant lspA from related species has been successfully expressed and shown to complement lspA-deficient E. coli strains and confer globomycin resistance .

How can researchers effectively generate and validate lspA knockout or knockdown strains in L. johnsonii?

Creating and validating lspA-deficient L. johnsonii strains requires careful methodology:

  • Knockout generation strategies:

    • Homologous recombination with suicide vectors

    • CRISPR-Cas9 system for precise gene editing

    • Antisense RNA for knockdown approaches (preferred if lspA is essential)

    • Inducible promoter replacement for conditional knockouts

  • Transformation considerations:

    • Electroporation optimization for Lactobacillus (field strength, buffer composition)

    • Temperature-sensitive plasmids for allelic exchange

    • Recovery media supplementation with cell wall precursors

  • Selection and screening methods:

    • Antibiotic resistance markers (erythromycin, chloramphenicol)

    • Counterselection with sacB or pheS systems

    • Colony PCR for initial screening

    • Whole genome sequencing to confirm single integration and absence of off-target effects

  • Validation of knockout/knockdown:

    • qRT-PCR to confirm absence or reduction of lspA transcript

    • Western blotting with lspA-specific antibodies

    • Functional assays to confirm phenotypic effects:

      • Accumulation of prolipoprotein precursors

      • Altered sensitivity to globomycin

      • Changes in cell membrane composition

  • Phenotypic characterization:

    • Growth curve analysis under various conditions

    • Stress tolerance assays (acid, bile, oxidative stress)

    • Host cell adhesion and colonization studies

    • Lipidomic and proteomic analysis of membrane composition

Given that lspA may be essential, conditional knockdown systems or partial deletions might be necessary if complete knockout attempts are unsuccessful.

What bioinformatic tools and pipelines are recommended for identifying putative lspA substrates in L. johnsonii?

Comprehensive identification of putative lspA substrates requires a multi-step bioinformatic approach:

  • Signal peptide and lipobox prediction:

    • LipoP 1.0: Specific prediction of bacterial lipoproteins

    • SignalP 6.0: General signal peptide prediction

    • PRED-LIPO: Lipoprotein prediction for Gram-positive bacteria

    • ProLipoP: Integrates multiple features for improved accuracy

  • Transmembrane domain analysis:

    • TMHMM: Prediction of transmembrane helices

    • HMMTOP: Alternative algorithm for membrane protein topology

  • Homology-based identification:

    • BLASTp searches against characterized bacterial lipoproteins

    • HMM profiles of known lipoprotein families

    • OrthoMCL for ortholog identification across species

  • Structural prediction:

    • AlphaFold2: Protein structure prediction to identify surface-exposed domains

    • I-TASSER: Alternative structure prediction method

  • Functional annotation:

    • InterProScan: Integrated protein domain analysis

    • KEGG Pathway mapping: Functional context assessment

    • Gene Ontology enrichment: Identification of overrepresented functional categories

  • Data integration pipeline:

    • Filter criteria: Presence of type II signal peptide, lipobox motif, absence of multiple transmembrane domains

    • Scoring system based on multiple prediction tools

    • Machine learning approaches for improved accuracy

Based on similar analyses in other bacterial species, researchers can expect approximately 1-2% of the L. johnsonii proteome to be lipoproteins processed by lspA .

What factors should be considered when designing globomycin resistance assays to validate lspA function?

Globomycin resistance assays are valuable tools for validating lspA function, but require careful methodological considerations:

  • Assay design parameters:

    • Concentration range: Typically 1-100 μg/ml globomycin

    • Growth medium selection: Minimal vs. rich media effects

    • Incubation conditions: Temperature, aeration, time course

    • Readout methods: Optical density, viable count, metabolic activity (resazurin)

  • Controls and comparisons:

    • Positive control: Known globomycin-resistant strain

    • Negative control: Wild-type strain without lspA overexpression

    • Vector-only control: To account for plasmid burden effects

    • Dose-response curves: EC50 determination for quantitative comparison

  • Expression verification:

    • Western blot confirmation of recombinant lspA expression

    • qRT-PCR to quantify expression levels

    • Correlation between expression level and resistance phenotype

  • Growth condition variables:

    • pH effects on globomycin activity

    • Growth phase dependency (exponential vs. stationary)

    • Media composition effects (cation concentration, etc.)

  • Data analysis approach:

    • Statistical comparison of growth parameters

    • Time-to-inhibition metrics

    • Area under curve calculations for growth curves

    • IC50 determination for quantitative comparison

For meaningful results, researchers should standardize assay conditions and ensure that resistance is specifically attributable to lspA activity rather than non-specific effects. Similar approaches have been used successfully to validate recombinant lspA activity from other bacterial species .

How does lspA function contribute to L. johnsonii's probiotic properties and health benefits?

The lspA-mediated lipoprotein processing in L. johnsonii likely contributes significantly to its probiotic properties through several mechanisms:

  • Pathogen antagonism:

    • Processed lipoproteins may contribute to antimicrobial activity

    • Surface lipoproteins facilitate competitive exclusion of pathogens

    • Example: Antagonism against Helicobacter pylori involves surface proteins potentially processed by lspA

  • Immunomodulation:

    • Properly processed lipoproteins interact with host pattern recognition receptors

    • These interactions help establish balanced immune responses

    • Contribute to L. johnsonii's ability to reduce chronic inflammation

  • Epithelial barrier enhancement:

    • Lipoproteins may contribute to increasing tight junction protein expression

    • Help repair compromised barriers

    • Support L. johnsonii's role in enhancing epithelial integrity

  • Adhesion and colonization:

    • Surface lipoproteins mediate bacterial attachment to host tissues

    • Enable persistent colonization of vaginal and gastrointestinal niches

    • Facilitate biofilm formation and microcolony development

  • Stress resistance:

    • Properly processed lipoproteins contribute to cell envelope integrity

    • Enhance survival under acidic conditions and bile exposure

    • Improve persistence in challenging host environments

Understanding lspA's role in these processes could inform the development of enhanced probiotic strains with improved therapeutic properties for various conditions, including inflammatory bowel disease, vaginal dysbiosis, and metabolic disorders.

What are the comparative differences between lspA in L. johnsonii and other Lactobacillus species?

While specific comparative data on lspA across Lactobacillus species is limited in the provided search results, we can outline a framework for such comparison:

FeatureL. johnsoniiOther Lactobacillus SpeciesPotential Research Implications
Sequence conservationBaseline for comparisonVariable conservation levelsIdentification of species-specific functional domains
Substrate specificityTo be determinedMay vary based on ecological nicheDesign of species-specific inhibitors
Expression patternsLikely dynamic based on growth phaseMay vary by species and environmentUnderstanding adaptation to different host niches
Genetic contextAdjacent genes may include other lipoprotein processing enzymesVariable genetic neighborhoodsInsights into co-evolution of lipoprotein processing
Catalytic efficiencyTo be determinedMay correlate with lipoprotein dependencyEngineering more efficient processing systems

Comparative genomic and functional studies would reveal how lspA variation contributes to the distinct ecological adaptations of different Lactobacillus species. For instance, L. johnsonii has been isolated from various vertebrate hosts and niches, suggesting its lspA may have broad substrate specificity to accommodate the diverse lipoprotein requirements of different environments .

How can understanding lspA function in L. johnsonii advance the development of engineered probiotic therapies?

Understanding lspA function in L. johnsonii provides several avenues for advancing engineered probiotic therapies:

  • Platform development for heterologous protein expression:

    • The lipoprotein processing pathway can be exploited to anchor therapeutic proteins to the bacterial surface

    • Example: Recombinant L. johnsonii expressing bovine GM-CSF has shown efficacy in reducing inflammation in bovine endometritis models

    • This approach could be extended to express other therapeutic proteins

  • Enhanced colonization and persistence:

    • Optimization of lspA function could improve colonization efficiency

    • Longer persistence in target tissues increases therapeutic window

    • Targeted mutagenesis of lspA could create strains with tissue-specific adhesion properties

  • Tailored immunomodulatory properties:

    • Engineering the lipoprotein profile through lspA modification

    • Development of strains with enhanced anti-inflammatory properties

    • Creation of adjuvant strains for vaccine applications

  • Pathogen-specific antagonism:

    • Enhancement of antimicrobial compound production

    • Engineering strains with improved ability to exclude specific pathogens

    • Development of niche-specific protective strains (e.g., vaginal, intestinal)

  • Biosensing and responsive therapeutics:

    • Creation of strains that respond to specific environmental cues

    • Development of diagnostic strains that signal pathological conditions

    • Conditional expression of therapeutic molecules

These applications represent promising directions for the development of next-generation probiotic therapeutics. The recent success with recombinant L. johnsonii expressing bovine GM-CSF for treating endometritis demonstrates the feasibility of such approaches .

What are the implications of lspA research for understanding L. johnsonii adaptation to different host environments?

Research on lspA in L. johnsonii has significant implications for understanding how this bacterium adapts to diverse host environments:

  • Niche-specific lipoprotein profiles:

    • Different host niches may require specific lipoprotein compositions

    • lspA activity may be regulated according to environmental conditions

    • The efficiency of lipoprotein processing could affect adaptation to new environments

  • Host-specific interactions:

    • Host species may recognize L. johnsonii lipoproteins differently

    • lspA-processed lipoproteins may mediate host-specific adhesion

    • Variation in lspA function could explain host range differences between strains

  • Environmental sensing mechanisms:

    • lspA expression patterns may serve as indicators of environmental adaptation

    • Similar to observations in other bacteria, L. johnsonii likely shows differential expression of lspA under varying conditions

    • This differential expression could reflect adaptive responses to host factors

  • Evolution of host specificity:

    • Comparative analysis of lspA across L. johnsonii strains from different hosts

    • Identification of selective pressures on lipoprotein processing machinery

    • Insights into co-evolution of bacteria with their hosts

  • Stress response coordination:

    • lspA function may be integrated with wider stress response networks

    • Adaptation to host defense mechanisms could involve regulated lipoprotein processing

    • Understanding these networks could reveal adaptation mechanisms

Detailed characterization of lspA function across different growth conditions and host environments would provide valuable insights into the molecular basis of L. johnsonii's adaptability, with implications for its use as a probiotic in different host species.

How does lspA contribute to the competitive fitness of L. johnsonii in complex microbial communities?

The role of lspA in L. johnsonii's competitive fitness within complex microbial communities likely involves several key mechanisms:

  • Resource acquisition and utilization:

    • lspA-processed lipoproteins may include nutrient-binding proteins

    • Enhanced nutrient uptake systems provide competitive advantage

    • Specialized metabolic adaptations mediated by surface lipoproteins

  • Niche defense mechanisms:

    • Production of bacteriocins and antimicrobial compounds

    • Creation of microenvironmental conditions unfavorable to competitors

    • Example: L. johnsonii can inhibit oral pathobionts associated with periodontitis through anti-biofilm activity

  • Interspecies communication:

    • Surface lipoproteins may mediate cell-cell interactions

    • Quorum sensing systems that monitor population density

    • Coordination of community-level behaviors

  • Host interaction optimization:

    • Properly processed lipoproteins mediate specific host tissue interactions

    • Immune system modulation to create favorable growth conditions

    • Alteration of host secretions to favor growth of L. johnsonii

  • Stress response coordination:

    • Enhanced survival under host-imposed stresses

    • Improved persistence during community perturbations

    • Rapid adaptation to changing environmental conditions

Understanding these mechanisms could inform strategies to enhance the competitive fitness of L. johnsonii in therapeutic applications, particularly in cases where establishing and maintaining colonization is challenging, such as in the presence of established dysbiotic communities.

What emerging technologies could advance the study of lspA function in L. johnsonii?

Several cutting-edge technologies show promise for advancing lspA research in L. johnsonii:

  • CRISPR-based technologies:

    • CRISPRi for tunable gene repression without gene deletion

    • Base editors for precise single nucleotide modifications in lspA

    • CRISPR-Cas screens to identify genetic interactions with lspA

  • Advanced imaging techniques:

    • Super-resolution microscopy to visualize lipoprotein localization

    • Live-cell imaging to track dynamic lipoprotein processing

    • Correlative light and electron microscopy for structural-functional relationships

  • Single-cell technologies:

    • Single-cell RNA-seq to capture heterogeneity in lspA expression

    • Spatial transcriptomics to map expression in mixed communities

    • Single-cell proteomics to quantify protein-level changes

  • Biosensor development:

    • FRET-based sensors for real-time monitoring of lspA activity

    • Fluorescent lipoprotein substrates to visualize processing events

    • Riboswitch-based reporters for in vivo activity monitoring

  • Multi-omics integration approaches:

    • Combined transcriptomics, proteomics, and metabolomics analyses

    • Machine learning algorithms to identify complex regulatory patterns

    • Network analysis tools to place lspA in broader cellular contexts

  • Microfluidic systems:

    • Organ-on-a-chip models for host-microbe interaction studies

    • Droplet microfluidics for high-throughput screening

    • Gradient generators to study responses to environmental variables

These technologies could provide unprecedented insights into the dynamics and functional significance of lspA-mediated lipoprotein processing in L. johnsonii, potentially leading to novel applications in probiotic development and therapeutic strategies.

What are the key unresolved questions regarding lspA function in L. johnsonii?

Despite progress in understanding bacterial lipoprotein processing, several critical questions about lspA in L. johnsonii remain unanswered:

  • Substrate specificity determinants:

    • What features in L. johnsonii lipoproteins determine their recognition by lspA?

    • How does substrate specificity differ from other bacterial species?

    • Are there strain-specific variations in substrate recognition?

  • Regulatory mechanisms:

    • How is lspA expression regulated in response to environmental conditions?

    • What transcription factors control lspA expression?

    • Are there post-translational modifications that modulate lspA activity?

  • Structural characteristics:

    • What is the three-dimensional structure of L. johnsonii lspA?

    • How does structure influence function and substrate specificity?

    • Are there unique structural features compared to other bacterial lspA proteins?

  • Physiological significance:

    • Is lspA essential for L. johnsonii viability under all conditions?

    • What is the minimum set of lipoproteins that must be processed for survival?

    • How does lipoprotein processing contribute to stress resistance?

  • Host interaction implications:

    • How do lspA-processed lipoproteins influence host immune responses?

    • Are there host-specific adaptations in lipoprotein processing?

    • Can engineering lspA enhance probiotic properties in specific host niches?

  • Evolutionary considerations:

    • How has lspA evolved in L. johnsonii compared to other Lactobacillus species?

    • Is there evidence for horizontal gene transfer of lspA or its substrates?

    • What selective pressures have shaped lspA function?

Addressing these questions will require integrative approaches combining structural biology, genetics, biochemistry, and in vivo models to fully elucidate the role of lspA in L. johnsonii physiology and host interactions.

What interdisciplinary approaches could enhance our understanding of L. johnsonii lspA in therapeutic applications?

Advancing L. johnsonii lspA research for therapeutic applications would benefit from several interdisciplinary approaches:

  • Systems biology and synthetic biology integration:

    • Whole-cell modeling of lipoprotein processing pathways

    • Design of synthetic regulatory circuits to control lspA expression

    • Prediction of system-wide effects of lspA modification

  • Immunology and microbiome science collaboration:

    • Characterization of immune responses to engineered L. johnsonii strains

    • Understanding microbiome community effects of modified strains

    • Development of targeted immunomodulatory applications

  • Pharmaceutical sciences and bioengineering:

    • Formulation strategies to enhance delivery and stability

    • Controlled release systems for engineered L. johnsonii

    • Scale-up and manufacturing process development

  • Clinical microbiology and translational medicine:

    • Patient-specific response prediction models

    • Biomarker development for therapeutic monitoring

    • Clinical trial design for probiotics and live biotherapeutics

  • Computational biology and artificial intelligence:

    • Machine learning for predicting optimal lspA modifications

    • In silico screening of potential inhibitors or enhancers

    • Network analysis to predict off-target effects

  • Evolutionary biology and ecology:

    • Understanding co-evolution of lspA with host immunity

    • Ecological modeling of engineered strain persistence

    • Horizontal gene transfer risk assessment

Such interdisciplinary approaches could accelerate the development of L. johnsonii-based therapeutics, particularly for conditions where targeted modulation of host-microbe interactions is beneficial, such as inflammatory bowel disease, vaginal dysbiosis, or metabolic disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.