Recombinant Lactobacillus johnsonii Protein CrcB homolog 2 (crcB2)

Shipped with Ice Packs
In Stock

Description

Antimicrobial and Stress Resistance

  • Camphor Resistance: CrcB homologs are implicated in resistance to toxic compounds like camphor, potentially by modulating membrane permeability or efflux mechanisms .

  • Fluoride Ion Defense: The crcB operon in related species includes fluoride-responsive riboswitches, suggesting CrcB2 may contribute to fluoride ion homeostasis or detoxification .

Microbial Interactions

  • Pathogen Inhibition: While L. johnsonii employs hydrogen peroxide, lactic acid, and bile-salt hydrolase (BSH) to combat pathogens , crcB2’s direct antimicrobial role remains understudied. Its stress-resistance properties may enhance L. johnsonii’s survival in hostile environments, indirectly supporting its probiotic functions.

Comparative Analysis of Recombinant CrcB Homologs

SpeciesGene NameProtein FunctionHost SystemPurity
Lactobacillus johnsoniiLJ_RS03795Camphor resistance proteinE. coli/Yeast≥85%
Bacillus subtilisyhdVIntegral membrane proteinMammalian cells≥85%
Staphylococcus aureuscrcB2Chromosome condensation proteinCell-free expression≥85%

Key Findings

  • Biotechnological Utility: Recombinant crcB2 production enables studies on bacterial stress adaptation and probiotic engineering .

  • Therapeutic Potential: Engineered L. johnsonii strains (e.g., GM-CSF-expressing variants ) highlight the species’ adaptability for delivering bioactive proteins, a framework that could extend to crcB2 for enhanced stress tolerance or antimicrobial activity.

Research Gaps and Future Directions

  • Mechanistic Studies: Clarify crcB2’s role in L. johnsonii’s stress response, particularly its interaction with fluoride ions or bile salts .

  • Probiotic Engineering: Explore crcB2 overexpression to improve L. johnsonii’s resilience in the gut microenvironment, amplifying its antimicrobial or anti-inflammatory effects .

  • Bioremediation: Investigate crcB2’s potential in detoxifying environmental pollutants, leveraging its putative ion-transport functions .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please specify your preference when placing the order, and we will prepare it accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you require a specific tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
crcB2; LJ_0897; Putative fluoride ion transporter CrcB 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Target Names
crcB2
Target Protein Sequence
MITVLTAGFGAIWGAILRYGITNYGKKHWSEKFPYATLLINLTGAFLLGFIFSRKFSPFI YALIGTGVLGGYTTFSTLNVELLSHWRDRNYSVFTLYALLSYGGGLILVFLGYKVGTLI
Uniprot No.

Target Background

Function
CrcB2 plays a crucial role in reducing fluoride concentration within cells, mitigating its toxicity.
Database Links

KEGG: ljo:LJ_0897

STRING: 257314.LJ0897

Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Lactobacillus johnsonii and what makes it significant for protein research?

Lactobacillus johnsonii is a commensal bacterium isolated from the vaginal and gastrointestinal (GI) tracts of vertebrate hosts, including humans, rodents, swine, and poultry . L. johnsonii strains have gained significant attention in research due to their multiple health-promoting properties, including pathogen antagonism, control of mucosal and systemic immune responses, reduction of chronic inflammation, modulation of metabolic disorders, and enhancement of epithelial barrier function . These properties make L. johnsonii proteins, including CrcB homolog 2, valuable targets for recombinant protein studies aimed at understanding host-microbe interactions and potential therapeutic applications.

What are the general approaches for expressing recombinant proteins from Lactobacillus species?

For recombinant expression of Lactobacillus proteins, researchers typically employ several methodological approaches:

  • Vector selection: Specialized expression vectors compatible with either E. coli or lactic acid bacteria hosts are selected based on the specific characteristics of the target protein.

  • Codon optimization: Gene sequences are optimized for the host expression system to enhance protein yield, particularly important when expressing Lactobacillus proteins in heterologous systems.

  • Expression systems:

    • E. coli systems (BL21, Rosetta strains) for high yield

    • Lactic acid bacteria expression systems (L. lactis, L. plantarum) for proper folding of proteins requiring specific post-translational modifications

    • Yeast expression systems (P. pastoris) for proteins requiring eukaryotic folding machinery

  • Induction conditions: Optimized temperature, induction agent concentration, and timing to maximize soluble protein production.

The choice of expression system is particularly critical as it directly influences protein folding, activity, and yield.

How does the CrcB protein family function in bacterial systems?

The CrcB protein family, to which CrcB homolog 2 belongs, typically functions in ion transport and homeostasis in bacterial systems. While specific data on CrcB homolog 2 in L. johnsonii is limited in current literature, research on related CrcB proteins suggests they may be involved in:

  • Fluoride ion channel activity and resistance

  • Maintenance of membrane potential

  • Potential roles in stress response pathways

  • Ion homeostasis that may contribute to antimicrobial resistance mechanisms

Understanding these functions provides crucial context for researchers working with recombinant CrcB homolog 2 from L. johnsonii, particularly when designing functional assays.

What are the optimal expression and purification strategies for recombinant L. johnsonii proteins?

Successful expression and purification of recombinant L. johnsonii proteins, including CrcB homolog 2, requires careful optimization:

Expression optimization protocol:

  • Clone the crcB2 gene with appropriate affinity tags (His6, GST, or MBP)

  • Transform into expression hosts (E. coli BL21(DE3) for initial attempts)

  • Test expression at varied temperatures (16°C, 25°C, and 37°C) and induction conditions

  • Screen for soluble protein expression via small-scale test inductions

  • Scale up using optimized conditions determined from test expressions

Purification strategy:

  • Initial capture via affinity chromatography (IMAC for His-tagged constructs)

  • Secondary purification via ion exchange chromatography

  • Final polishing via size exclusion chromatography

  • Quality assessment using SDS-PAGE and Western blotting

Addressing common challenges:

  • The addition of detergents (0.1% Triton X-100) may improve solubility of membrane-associated proteins

  • Expression at lower temperatures (16°C) often improves proper folding

  • Inclusion of stabilizing agents (5-10% glycerol) in purification buffers can enhance stability

What analytical methods are most effective for characterizing recombinant L. johnsonii CrcB homolog 2?

A comprehensive characterization workflow includes:

Analytical MethodInformation ObtainedExperimental Parameters
Circular Dichroism (CD)Secondary structure compositionFar-UV (190-260 nm) wavelength scan
Size Exclusion Chromatography with Multi-Angle Light Scattering (SEC-MALS)Oligomeric state and homogeneityMolecular weight determination in solution
Differential Scanning Fluorimetry (DSF)Thermal stability and buffer optimizationTemperature gradient (25-95°C)
Mass SpectrometryMass confirmation and post-translational modificationsMALDI-TOF or ESI-MS analysis
Functional AssaysActivity verificationIon transport assays, membrane potential assays

The thermal stability assessment is particularly important as it provides insights into proper folding and helps identify stabilizing buffer conditions for subsequent functional studies.

How can researchers design meaningful functional assays for recombinant CrcB homolog 2?

Designing functional assays for CrcB homolog 2 requires considering its putative ion channel and homeostasis functions:

  • Ion flux assays:

    • Liposome-based fluorescence assays with ion-sensitive dyes

    • Patch-clamp electrophysiology when incorporated into artificial membranes

    • Radioisotope flux measurements in reconstituted systems

  • Bacterial survival assays:

    • Complementation studies in CrcB knockout strains

    • Challenge with ion stressors (fluoride, other halides)

    • Growth curve analysis under variable ion concentrations

  • Interaction studies:

    • Pull-down assays to identify binding partners

    • Surface plasmon resonance to determine binding kinetics

    • Crosslinking studies to capture transient interactions

These assays should be designed with appropriate positive and negative controls, including well-characterized ion transporters and inactive mutants of CrcB homolog 2.

How might CrcB homolog 2 contribute to L. johnsonii's antimicrobial properties?

L. johnsonii strains have been observed to produce antimicrobial effects against various pathogens through multiple mechanisms . Potential contributions of CrcB homolog 2 to these antimicrobial properties may include:

  • Ion homeostasis modulation: CrcB homolog 2 may regulate ion concentrations that influence pathogen survival in the microenvironment.

  • Membrane integrity maintenance: By maintaining proper ion balance, CrcB homolog 2 could support production of antimicrobial compounds like hydrogen peroxide (H₂O₂) and lactic acid, which L. johnsonii produces to inhibit pathogens such as Salmonella enterica serovar Typhimurium, pathogenic E. coli, and Gardnerella vaginalis .

  • Synergistic effects: CrcB homolog 2 might work cooperatively with other antimicrobial mechanisms, similar to how H₂O₂ and lactic acid work together in L. johnsonii to inhibit pathogens .

  • pH-dependent mechanisms: Considering that L. johnsonii's inhibition of Salmonella occurs at pH 4.5 but not at pH 6.5 , CrcB homolog 2 may participate in pH-dependent antimicrobial activities.

Research examining recombinant CrcB homolog 2 in controlled systems could elucidate its specific contributions to these antimicrobial properties.

What techniques can assess interactions between CrcB homolog 2 and host immune cells?

Given L. johnsonii's role in immune modulation , researchers investigating CrcB homolog 2 interactions with immune cells should consider:

  • Ex vivo immune cell assays:

    • Dendritic cell maturation assays (measuring CD80/CD86 expression)

    • Cytokine production profiles (IL-10, IL-12, TNF-α, IL-6)

    • T-cell polarization assays (Th1/Th2/Th17/Treg)

  • Receptor binding studies:

    • Biotinylated protein binding to immune cell surfaces

    • Competitive inhibition with known immune receptors

    • FRET-based interaction studies with fluorescently labeled receptors

  • Signaling pathway analysis:

    • Phosphorylation of ERK1/2, which is modulated by cannabinoid receptor systems and may be relevant to immune modulation

    • NF-κB pathway activation or suppression

    • MAPK pathway analysis, which has been implicated in endocannabinoid actions within the CNS immune system

A systematic approach analyzing these interactions can reveal whether CrcB homolog 2 contributes to the observed immunomodulatory effects of L. johnsonii strains.

How does CrcB homolog 2 compare structurally and functionally to homologous proteins in other probiotic species?

Comparative analysis of CrcB homolog 2 with similar proteins from other probiotic species can provide evolutionary and functional insights:

SpeciesCrcB HomologSequence Identity (%)Key Functional DifferencesStructural Features
L. acidophilusCrcB75-85 (predicted)May have different ion selectivitySimilar predicted transmembrane domains
L. reuteriCrcB65-75 (predicted)Potentially different regulationVariations in cytoplasmic domains
L. caseiCrcB70-80 (predicted)May function in different stress responsesConservation in pore-forming regions
B. longumCrcB-like40-50 (predicted)Different taxonomic adaptationsDivergent N-terminal region

Structural modeling techniques, such as homology modeling based on available CrcB structures, can identify conserved functional domains and species-specific adaptations. Heterologous expression studies comparing these homologs can determine whether functional differences correlate with species-specific probiotic properties.

What are common artifacts in recombinant protein studies of L. johnsonii proteins and how can they be addressed?

When working with recombinant L. johnsonii proteins, including CrcB homolog 2, researchers frequently encounter these artifacts and challenges:

  • Expression-induced conformational changes:

    • Issue: Non-native folding due to heterologous expression

    • Solution: Compare multiple expression systems; validate with conformational antibodies; perform parallel studies with native protein

  • Tag interference with protein function:

    • Issue: Affinity tags disrupting protein activity or interactions

    • Solution: Test multiple tag positions (N-terminal vs. C-terminal); include tag-removal options; compare tagged vs. untagged protein behavior

  • Lipopolysaccharide (LPS) contamination:

    • Issue: Bacterial expression systems introducing LPS that confounds immunological studies

    • Solution: Implement rigorous endotoxin removal; use LAL assays to quantify endotoxin levels; include polymyxin B controls in immune assays

  • Aggregation during concentration:

    • Issue: Protein aggregation during concentration steps

    • Solution: Optimize buffer conditions (add glycerol/detergents); use gentle concentration methods; perform dynamic light scattering to monitor aggregation

Thorough controls and method validation are essential to distinguish genuine biological effects from technical artifacts.

How can contradictory findings about L. johnsonii proteins be reconciled in the research literature?

Contradictory findings regarding L. johnsonii proteins can be addressed through:

  • Strain specificity analysis: Different L. johnsonii strains show varying effects; for example, L. johnsonii NCC 533 inhibits Salmonella through H₂O₂ production , while other strains may employ different mechanisms. Researchers should explicitly identify and compare specific strains.

  • Context-dependent activity: L. johnsonii exhibits pH-dependent antimicrobial activity, inhibiting Salmonella at pH 4.5 but not at pH 6.5 . Experimental conditions must be carefully controlled and reported.

  • Methodological standardization: Develop consensus protocols for:

    • Protein purification quality standards

    • Functional assay conditions

    • Cell culture systems and passage numbers

    • In vivo model selection and housing conditions

  • Multi-laboratory validation: Implement collaborative studies with standardized materials and protocols across independent laboratories to confirm reproducibility of key findings.

When reviewing contradictory literature, researchers should create comparison tables documenting experimental conditions alongside results to identify variables potentially explaining discrepancies.

What statistical approaches best analyze dose-response relationships for recombinant bacterial proteins?

Robust statistical analysis of dose-response relationships for recombinant bacterial proteins requires:

  • Model selection:

    • Four-parameter logistic (4PL) models for sigmoidal responses

    • Five-parameter logistic (5PL) models for asymmetric responses

    • Biphasic models for complex response patterns

  • Experimental design considerations:

    • Minimum of 8-12 concentration points, logarithmically spaced

    • At least 3-4 biological replicates

    • Include controls for maximum and minimum responses

  • Advanced statistical methods:

    • Bootstrapping for confidence interval estimation

    • ANOVA with post-hoc tests for comparing EC50/IC50 values

    • AIC/BIC criteria for model selection

Sample dose-response equation for 4PL model:
Y=Bottom+TopBottom1+(EC50X)HillSlopeY = Bottom + \frac{Top - Bottom}{1 + (\frac{EC_{50}}{X})^{Hill Slope}}

For comparing potency between different protein preparations or mutants, researchers should report EC50/IC50 values with 95% confidence intervals rather than single-point activity measurements.

How might structural biology techniques advance understanding of CrcB homolog 2 function?

Advanced structural biology approaches offer promising avenues for elucidating CrcB homolog 2 function:

  • Cryo-electron microscopy (cryo-EM):

    • Can resolve membrane protein structures in near-native conditions

    • Potentially capture different conformational states during ion transport

    • May reveal oligomerization patterns critical for function

  • Advanced NMR techniques:

    • Solid-state NMR for membrane-embedded structure determination

    • Solution NMR for dynamics studies of soluble domains

    • Chemical shift perturbation assays to map interaction interfaces

  • Integrative structural biology:

    • Combining X-ray crystallography, SAXS, and computational modeling

    • Molecular dynamics simulations to study ion permeation mechanisms

    • In silico docking studies to identify potential small molecule modulators

  • High-throughput mutation analysis:

    • Deep mutational scanning to identify critical residues

    • Structure-guided mutagenesis of predicted functional domains

    • Evolutionary coupling analysis to identify co-evolving residues

Each of these approaches can address specific aspects of CrcB homolog 2 function, from basic structural characterization to detailed mechanistic understanding of its ion transport properties.

How can CRISPR-Cas9 technology advance functional studies of CrcB homolog 2?

CRISPR-Cas9 technology offers transformative approaches for studying CrcB homolog 2:

  • Precise genomic manipulation in L. johnsonii:

    • Knockout studies to assess phenotypic effects of CrcB homolog 2 deletion

    • Introduction of point mutations to test structure-function hypotheses

    • Promoter modifications to study expression regulation

  • CRISPRi for conditional expression studies:

    • Temporal control of CrcB homolog 2 expression

    • Tissue-specific or condition-specific knockdown in colonization models

    • Dosage-dependent phenotype analysis

  • CRISPR-based screening approaches:

    • Identification of genetic interactions with CrcB homolog 2

    • Discovery of regulators affecting CrcB homolog 2 expression

    • Genome-wide screens for synthetic lethality

  • Base editing applications:

    • Precise amino acid substitutions without double-strand breaks

    • Modification of regulatory elements controlling CrcB homolog 2 expression

    • Introduction of epitope tags at endogenous loci

These CRISPR-based approaches can overcome limitations of traditional genetic manipulation techniques in lactobacilli and provide unprecedented insights into CrcB homolog 2 function in its native context.

What are the potential applications of CrcB homolog 2 in synthetic biology and microbiome engineering?

Emerging applications of CrcB homolog 2 in synthetic biology and microbiome engineering include:

  • Engineered probiotics:

    • Development of L. johnsonii strains with modified CrcB homolog 2 expression for enhanced colonization

    • Creation of stress-resistant probiotic strains through CrcB engineering

    • Fine-tuning of ion homeostasis for improved viability in the GI tract

  • Biosensor development:

    • Engineering CrcB homolog 2 as a reporter for specific ion concentrations

    • Development of whole-cell biosensors for environmental monitoring

    • Creation of diagnostic tools for intestinal ion composition

  • Therapeutic delivery systems:

    • Utilizing L. johnsonii's natural anti-inflammatory properties , potentially enhanced through CrcB homolog 2 optimization

    • Engineering L. johnsonii as a delivery vehicle for therapeutic proteins

    • Development of synbiotic formulations combining engineered L. johnsonii with specific prebiotics

  • Microbiome modulators:

    • Design of L. johnsonii variants with enhanced ability to modulate specific microbiome compositions

    • Development of strains that can outcompete pathogenic bacteria through modified ion transport capacity

    • Creation of conditional fitness advantages for beneficial community members

These applications build upon L. johnsonii's established roles in immune modulation and pathogen antagonism , potentially enhanced through rational engineering of CrcB homolog 2.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.