Recombinant Lactobacillus johnsonii UPF0397 protein LJ_1703 (LJ_1703)

Shipped with Ice Packs
In Stock

Description

Genomic Annotations

  • COG Classification: LJ_1703 is annotated as a member of the UPF0397 family, a group of conserved hypothetical proteins with unknown enzymatic activity .

  • Pathogen-Host Interaction: L. johnsonii strains encode stress-resistance machinery (e.g., S-layer proteins, ABC transporters) that protect against gut pathogens . LJ_1703’s genomic neighbors include genes for peptidases and transporters, suggesting involvement in nutrient uptake or microbial competition .

Hypothesized Roles

  • Structural Integrity: LJ_1703 may contribute to the S-layer or extracellular matrix, aiding in adhesion to host epithelial cells .

  • Antimicrobial Activity: L. johnsonii produces metabolites (e.g., lactic acid, H₂O₂) and enzymes (e.g., bile-salt hydrolase) to inhibit pathogens like Salmonella and E. coli . LJ_1703’s role in these pathways is speculative but plausible given its localization in stress-response genomic regions .

Experimental Notes

  • Stability: Avoid repeated freeze-thaw cycles; aliquot for multiple uses .

  • Activity Assays: Functional studies require reconstitution in optimized buffers (e.g., Tris/PBS with glycerol) .

Comparative Genomic Insights

A 2024 genomic study of L. johnsonii GJ231 highlighted features relevant to LJ_1703:

  • Stress Resistance: GJ231 encodes acid/bile tolerance genes (e.g., ATP-binding cassette transporters), which are critical for gut colonization .

  • Metabolic Flexibility: High phosphotransferase system (PTS) activity enables carbohydrate utilization, a trait shared across L. johnsonii strains .

Unresolved Questions

  • Pathway Involvement: No experimentally validated pathways are linked to LJ_1703, though in silico tools suggest interactions with membrane proteins .

  • Therapeutic Potential: While L. johnsonii probiotics show cardioprotective and anti-inflammatory effects , LJ_1703’s contribution to these outcomes remains uncharacterized.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For working aliquots, store at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
LJ_1703; UPF0397 protein LJ_1703
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-185
Protein Length
full length protein
Species
Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Target Names
LJ_1703
Target Protein Sequence
MNNQKGLSVKSVVAIGIGAAIYVILARFTSIPTGIPNTNIEIVYPFLALLATIYGPVVGF SVGFIGHALSDFLMYGQTWWSWVLATAVLGLIIGLYGMRLDLENGVFTTKQMIGFNIVQI IANVVSWLIIAPVGDILIYSEPQNKVFLQGATATITNSISILILGTILLKAYAATKVKKG SLRRD
Uniprot No.

Target Background

Database Links

KEGG: ljo:LJ_1703

STRING: 257314.LJ1703

Protein Families
UPF0397 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Lactobacillus johnsonii UPF0397 protein LJ_1703?

Lactobacillus johnsonii UPF0397 protein LJ_1703 is a full-length (185 amino acids) protein from Lactobacillus johnsonii strain CNCM I-12250/La1/NCC 533. The protein belongs to the UPF0397 protein family, which consists of proteins with unknown function. The protein has UniProt accession number Q74I63 and is encoded by the LJ_1703 gene in the L. johnsonii genome .

What is the amino acid sequence of LJ_1703?

The full amino acid sequence of LJ_1703 is: MNNQKGLSVKSVVAIGIGAAIYVILARFTSIPTGIPNTNIEIVYPFLALLATIYGPVVGFSVGFIGHALSDFLMYGQTWWSWVLATAVLGLIIGLYGMRLDLENGVFTTKQMIGFNIVQIIANVVSWLIIAPVGDILIYSEPQNKVFLQGATATITNSISILILGTILLKAYAATKVKKGSLRRD. This 185-amino acid sequence represents the complete protein as encoded by the LJ_1703 gene .

What expression systems are commonly used for recombinant production of LJ_1703?

Based on available data, E. coli is the primary expression system used for recombinant production of LJ_1703. This heterologous expression system allows for the production of His-tagged recombinant protein, facilitating subsequent purification steps. When designing expression experiments, researchers should consider optimization of codon usage, as bacterial expression systems may require codon optimization for efficient expression of proteins from different bacterial species .

What is currently known about the structural characteristics of LJ_1703?

Current structural information about LJ_1703 is limited. From sequence analysis, we can infer that the protein contains membrane-spanning regions, as suggested by the hydrophobic amino acid clusters in its sequence. The presence of multiple hydrophobic regions (e.g., "VAIGIGAAIYVILAR," "FLALLATIYGPVVGFSVGFIGHAL") indicates potential transmembrane domains. Researchers investigating this protein should consider standard membrane protein structural analysis techniques, including circular dichroism spectroscopy, X-ray crystallography (if crystallizable), or cryo-electron microscopy for structural determination .

What are the predicted functional domains in LJ_1703 and how can they be experimentally validated?

Methodological approach for functional domain validation:

  • Begin with bioinformatic prediction tools (TMHMM, SignalP, InterProScan) to identify potential functional domains.

  • Design site-directed mutagenesis experiments targeting conserved residues within predicted domains.

  • Express wild-type and mutant proteins in appropriate bacterial systems.

  • Conduct functional assays based on predicted activities (e.g., ion transport assays if a transporter function is predicted).

  • Use pull-down assays or co-immunoprecipitation to identify interacting partners that might suggest function.

  • Consider complementation studies in LJ_1703 knockout strains to assess functional recovery .

What are the optimal conditions for solubilizing and purifying recombinant LJ_1703?

As LJ_1703 appears to have membrane-associated characteristics, purification requires careful consideration:

  • Solubilization Strategy:

    • Use mild detergents (e.g., n-dodecyl-β-D-maltoside (DDM) or CHAPS) for initial solubilization from bacterial membranes.

    • Consider screening multiple detergents and concentrations (0.5-2%) to optimize extraction efficiency.

    • Include protease inhibitors to prevent degradation during extraction.

  • Purification Approach:

    • Utilize the His-tag for initial purification via nickel affinity chromatography.

    • Consider performing purification steps at 4°C to maintain protein stability.

    • Follow with size exclusion chromatography to achieve higher purity.

    • For functional studies, assess protein activity after each purification step to ensure functionality is maintained.

  • Buffer Composition:

    • Optimize buffer pH (typically 7.0-8.0 for membrane proteins).

    • Include glycerol (10-20%) to enhance stability.

    • Consider adding stabilizing agents such as specific lipids if destabilization is observed .

How should researchers design robust control experiments when investigating LJ_1703 function?

Designing robust controls for LJ_1703 functional studies requires a systematic approach:

  • Negative Controls:

    • Express and purify a non-functional mutant (e.g., with key predicted functional residues mutated).

    • Use the empty expression vector in parallel experiments.

    • Include a known unrelated protein from L. johnsonii with similar characteristics (size, membrane association) but different function.

  • Positive Controls:

    • If homologous proteins with known functions exist, include them in parallel experiments.

    • For interaction studies, include known interacting protein pairs to validate experimental conditions.

  • Validation Approaches:

    • Perform complementation studies in knockout strains.

    • Demonstrate specificity by showing that functionally similar proteins cannot substitute.

    • Include dose-response experiments to demonstrate specificity of observed effects.

    • Use multiple methods to confirm observations (e.g., if studying binding, use both pull-down and surface plasmon resonance) .

What methodological approaches are recommended for investigating potential protein-protein interactions of LJ_1703?

To investigate protein-protein interactions of LJ_1703, researchers should employ a multi-faceted approach:

  • In silico prediction:

    • Use computational tools like STRING, PSICQUIC, or HIPPIE to predict potential interacting partners based on genomic context, co-expression data, and evolutionary conservation.

  • Affinity-based experimental methods:

    • Perform co-immunoprecipitation using antibodies against LJ_1703 or its epitope tag.

    • Conduct pull-down assays using the recombinant His-tagged LJ_1703 as bait.

    • For membrane protein interactions, consider crosslinking experiments prior to solubilization to capture transient interactions.

  • Advanced techniques:

    • Bacterial two-hybrid systems may be more appropriate than yeast two-hybrid for bacterial protein interactions.

    • Proximity labeling approaches (BioID or APEX) adapted for bacterial systems can identify proteins in close proximity to LJ_1703 in vivo.

    • Förster resonance energy transfer (FRET) or bioluminescence resonance energy transfer (BRET) for studying interactions in living bacterial cells.

  • Validation and analysis:

    • Confirm interactions using at least two independent methods.

    • Perform domain mapping to identify specific regions involved in interactions.

    • Test the effect of specific mutations on interaction strength .

How can researchers effectively design experiments to elucidate the role of LJ_1703 in Lactobacillus johnsonii physiology?

To systematically investigate LJ_1703's role in L. johnsonii physiology:

  • Gene knockout and phenotypic analysis:

    • Generate LJ_1703 deletion mutants using CRISPR-Cas systems adapted for Lactobacillus or homologous recombination techniques.

    • Perform comprehensive phenotypic characterization including growth curves under various conditions (pH, temperature, nutrient limitation, stress conditions).

    • Assess membrane properties (permeability, potential) in wild-type versus knockout strains.

  • Complementation studies:

    • Reintroduce wild-type LJ_1703 to confirm phenotype restoration.

    • Introduce mutated versions to identify critical residues/regions.

  • Transcriptomic and proteomic analysis:

    • Compare global gene expression and protein profiles between wild-type and LJ_1703 knockout strains.

    • Analyze data using pathway enrichment tools to identify affected cellular processes.

  • Metabolomic analysis:

    • Assess changes in metabolite profiles to identify potential metabolic pathways affected by LJ_1703 absence.

    • Focus on membrane-associated metabolites if membrane localization is confirmed .

What are the common pitfalls in studying membrane-associated proteins like LJ_1703, and how can they be mitigated?

Membrane proteins present unique challenges that require specific solutions:

  • Expression challenges:

    • Pitfall: Toxicity to host cells due to membrane disruption.

    • Solution: Use tightly controlled inducible expression systems; consider lower expression temperatures (16-25°C); test multiple expression strains.

  • Solubility issues:

    • Pitfall: Formation of inclusion bodies or aggregates.

    • Solution: Optimize detergent screening; consider protein fusion partners that enhance solubility; test extraction conditions systematically.

  • Functional assessment difficulties:

    • Pitfall: Loss of function during purification.

    • Solution: Develop assays that can be performed in membrane fractions or detergent-solubilized states; consider reconstitution into liposomes or nanodiscs to maintain native-like membrane environment.

  • Structural instability:

    • Pitfall: Rapid degradation or conformation changes.

    • Solution: Include stabilizing agents (glycerol, specific lipids); optimize buffer conditions; consider crosslinking for stabilization during analysis.

  • Non-specific interactions:

    • Pitfall: Hydrophobic membrane proteins often show non-specific binding.

    • Solution: Include stringent washing steps in interaction studies; use appropriate detergent concentrations in buffers; include competition assays to demonstrate specificity .

How should researchers approach reproducibility challenges when working with recombinant LJ_1703?

Ensuring reproducibility with recombinant membrane proteins requires systematic approaches:

  • Standardization of expression conditions:

    • Document detailed expression protocols including media composition, induction parameters, and harvest times.

    • Maintain consistent cell density at induction.

    • Establish quality control checkpoints using SDS-PAGE and Western blot analysis.

  • Purification consistency:

    • Create detailed standard operating procedures for each purification step.

    • Use the same detergent lot numbers when possible, or characterize new lots.

    • Implement protein quality assessment metrics (e.g., monodispersity by dynamic light scattering).

  • Functional analysis standardization:

    • Develop quantitative assays with internal controls.

    • Include reference standards in each experimental batch.

    • Establish minimum acceptance criteria for protein quality before proceeding to functional studies.

  • Data management and reporting:

    • Document all experimental parameters meticulously.

    • Report batch-to-batch variation transparently.

    • Implement the experimental design principles outlined in the flow guidelines for data science to ensure methodological rigor .

What mass spectrometry-based approaches are recommended for studying post-translational modifications of LJ_1703?

To comprehensively analyze potential post-translational modifications (PTMs) of LJ_1703:

  • Sample preparation:

    • Purify LJ_1703 to high homogeneity (>95%) using affinity chromatography.

    • Process samples under conditions that preserve PTMs (avoid excessive heating, include phosphatase inhibitors if phosphorylation is suspected).

    • Perform parallel enrichment strategies for specific PTMs (e.g., TiO₂ for phosphopeptides, lectin affinity for glycopeptides).

  • MS analysis strategies:

    • Perform bottom-up proteomics using multiple proteases (trypsin, chymotrypsin, Glu-C) to improve sequence coverage.

    • Implement top-down proteomics to analyze the intact protein and preserve PTM combinations.

    • Use electron transfer dissociation (ETD) or electron capture dissociation (ECD) fragmentation methods which better preserve labile PTMs compared to collision-induced dissociation (CID).

  • Data analysis considerations:

    • Search for both predicted and unexpected modifications.

    • Validate PTM identifications using site-directed mutagenesis of modified residues.

    • Quantify the stoichiometry of identified modifications.

    • Compare PTM profiles under different growth or stress conditions to infer biological relevance .

How can bioinformatic approaches advance our understanding of LJ_1703 function when experimental data is limited?

When experimental data is sparse, computational approaches can provide valuable insights:

  • Evolutionary analysis:

    • Perform phylogenetic analysis of UPF0397 family proteins across bacterial species.

    • Identify conserved residues that may indicate functional importance.

    • Analyze gene neighborhood conservation to identify potential functional associations.

  • Structural prediction:

    • Apply AlphaFold2 or RoseTTAFold to predict tertiary structure.

    • Identify potential binding pockets or catalytic sites.

    • Perform molecular dynamics simulations to explore conformational flexibility.

  • Functional inference:

    • Use Gene Ontology term enrichment of co-expressed genes.

    • Apply protein-protein interaction network analysis to predict functional clusters.

    • Implement text mining of scientific literature for related proteins or systems.

  • Integration with existing data:

    • Correlate with transcriptomic data to identify conditions where LJ_1703 is differentially expressed.

    • Use NumSearchLLM or similar systems to leverage large language models alongside enterprise knowledge graphs to discover non-obvious relationships between LJ_1703 and other biological entities .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.