Recombinant Lactobacillus plantarum DNA translocase FtsK (ftsK)

Shipped with Ice Packs
In Stock

Description

Key Functional Properties

PropertyDescriptionSource
DNA translocation speed~5,000 bp/second
ATPase activityPowered by RecA-like nucleotide-binding fold in α/β domains
Protein interactionBinds XerCD recombinases to activate recombination at dif site
Localization dynamicsForms foci at septa and nucleoid during cell division

Recombinant Production and Characterization

The recombinant L. plantarum FtsK is produced as a full-length (1–795 amino acids) His-tagged protein in E. coli (see Table 1) .

Genome Segregation and Cell Division

FtsK coordinates chromosome segregation with cell division in both single- and multipartite genome bacteria:

  • Chromosome dimer resolution (CDR): Translocates DNA to resolve dimers via XerCD-mediated recombination at the dif site .

  • Multipartite genome management: In Deinococcus radiodurans, FtsK aligns foci at septa and nucleoids during division, ensuring accurate segregation of polyploid genomes .

Stress Response and Proteolytic Regulation

  • Heat shock regulation: L. plantarum ftsK is transcriptionally induced under heat stress, controlled by the CtsR repressor .

  • Proteolytic regulation: In Bacillus subtilis, FtsK modulates Sle1 peptidoglycan hydrolase levels, linking DNA translocation to cell wall remodeling .

Comparative Analysis Across Species

FtsK homologs share conserved structural motifs but exhibit species-specific adaptations (Table 2).

Table 2: FtsK Homologs in Gram-Positive Bacteria

SpeciesLength (aa)Key Functional RoleSource
Lactobacillus plantarum795Heat shock response, genome segregation
Lactococcus lactis755Cell division coordination
Xylella fastidiosa784Pathogenicity-related DNA translocation

Experimental Challenges and Future Directions

  • Domain-specific studies: Deletion mutants of L. plantarum FtsK (e.g., Δγ domain) alter membrane architecture and nucleoid morphology, highlighting its multifunctional role .

  • Radiation response: D. radiodurans FtsK upregulates post-irradiation, suggesting roles in DNA repair and genome reorganization .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: Our proteins are standardly shipped with normal blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please let us know, and we will prioritize developing the specified tag.
Synonyms
ftsK; lp_2210; DNA translocase FtsK
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-795
Protein Length
full length protein
Species
Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Target Names
ftsK
Target Protein Sequence
MARRQATTKKRRTSTRKKKPTVAAKRQMTGNVIGLIGLLVTILALLKVGLVGMVFAEFFR AIAGNAYQIFAGLTLLVMGYLMIFGRWPRLTWRWWVGGNLFFFSYLLLLEIPMFNQLNHH TDFWSLTWNLIKNDFAKGGMASNLGGGLVGAAGYSVTYPLLANVGTILIALILMVASIYI TFDLPFHKTMQALRQALMQLGQQLRSGYEWLTHVLRVQIARWRVHQQVRANQAASTEKQP TSTVPQSAAPAETTSGTSAPDSAASAVTSSPADLNITVASDREASPIKSPTSAATVDHEQ ELQGTEVMDDADYQLPESTLLTKIPKTDQSAEYATIESNSQKLTTTLASFGVQVEVKNVS LGPSVTKYELHPAVGVKVSKVVNLADDLALALAAKDLRIEAPIPGKSLIGIEVPNKQIST VSFRDIVEAQPAHPTKPLAVPLGRDVSGNLVVADLSKMPHLLIAGSTGSGKSVAINVMIT GLLMNTKPSQVKFMLIDPKKVELGVYNGIPHLLTPVVTEPKKAARALHKVVAEMERRYEL FADSKQRNMQGYNQYIRQQNAADGQSRPVLPYIVVVVDELADLMMVTSSEVEDAIIRLGQ MARAAGIHMILATQRPSVDVITGLIKANVPSRMAFAVSSGTDSRTIIDSNGAEKLLGRGD MLYQPMGMNKPLRVQGAYISDHDVEEVVNFIKAQQTADYDDSMLVKDDETDAAGSGDPRD GEDEYYAEAVELVTDQQSASVSMLQRRFRIGYNRAARIVDEMEERGVVGPSEGSKPRKVY RQKSADEAPASGNDA
Uniprot No.

Target Background

Function
Essential cell division protein that coordinates cell division and chromosome segregation. The N-terminus is involved in the assembly of the cell division machinery. The C-terminus functions as a DNA motor that moves dsDNA in an ATP-dependent manner towards the dif recombination site, located within the replication terminus region. It is required for the activation of the Xer recombinase, enabling the activation of chromosome unlinking by recombination.
Database Links

KEGG: lpl:lp_2210

STRING: 220668.lp_2210

Protein Families
FtsK/SpoIIIE/SftA family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.