Recombinant Lactobacillus plantarum Membrane protein insertase YidC 1 (yidC1)

Shipped with Ice Packs
In Stock

Description

Recombinant Production and Purity

Recombinant yidC1 is produced in heterologous systems (e.g., E. coli, cell-free expression) with varying purity levels. Below is a comparison of commercial recombinant yidC1 products:

SourceHost SystemPurityApplications
MyBioSource Cell-free expression≥85% (SDS-PAGE)Structural studies, in vitro insertion assays
Creative Biomart E. coliN/AVaccine development, immune modulation studies
CSB-CF771895LMS Cell-free expressionN/AELISA assays, antibody detection

Note: Partial yidC1 constructs are also available (e.g., residues 23–307) for targeted studies .

Two-Step Insertion Process

Single-molecule force spectroscopy and molecular dynamics simulations reveal:

  1. Initial Binding: yidC1’s cytoplasmic hairpin binds substrate polypeptides (e.g., Pf3 coat protein) within 2 ms .

  2. Insertion: Strengthened substrate binding occurs within 52 ms, followed by transfer to the membrane via the hydrophilic groove .

StepTime ScaleInteraction SiteOutcome
Binding2 msCytoplasmic helical hairpinSubstrate recognition
Insertion52 msHydrophilic grooveMembrane integration

Sec-Independent Activity

yidC1 can integrate single-pass membrane proteins (e.g., Pf3) into liposomes without Sec components . For example:

  • In vitro: Purified yidC1 efficiently inserts Pf3 into proteoliposomes (70% efficiency at 25 molecules/liposome) .

  • In vivo: A Pf3 mutant with an extended hydrophobic region inserts independently of yidC1 but is accelerated by its presence .

Vaccine Development

Recombinant L. plantarum expressing yidC1 has been engineered to display antigens (e.g., H7N9 hemagglutinin) for mucosal immunization:

  • Immune Activation: Induces DC maturation (↑CD80, CD86, MHC-II) and T-cell responses (↑IFN-γ+ CD4+/CD8+ cells) .

  • Antibody Production: Enhances IgG, IgA, and IgG2a titers in serum and mucosal compartments .

Membrane Protein Studies

yidC1 is used to study:

  • Insertion Kinetics: Real-time monitoring of substrate binding and lipid partitioning .

  • Structural Dynamics: Cryo-EM models of ribosome-bound yidC1 complexes .

Host-Microbe Interactions

L. plantarum expressing yidC1 modulates gut microbiota and epithelial barrier function:

  • Barrier Reinforcement: ↑Tight junction proteins (claudin-1, occludin) and ↓proinflammatory cytokines (IL-6, TNF-α) .

  • Microbiota Modulation: ↑Butyrate-producing bacteria (e.g., Faecalibacterium) and ↓pathogenic Clostridium .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery estimates, please consult your local distributor.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
yidC1; lp_1553; Membrane protein insertase YidC 1; Foldase YidC 1; Membrane integrase YidC 1; Membrane protein YidC 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
23-307
Protein Length
Full Length of Mature Protein
Species
Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Target Names
yidC1
Target Protein Sequence
CVQTTKAGKPYGFVYEYLAKPGQNVMEWLSQLFGNNYGWAIIGLTVIVRLVLLPMMINQQ RKSTYQQEKMSAVRPQMEKIQARQKAATTQEEKAAISNELMQLYRDNGISMTGGIGCLPL LIQLPIFSALYYAIRYSPELSKATFMGISLGKSSLILAILAFLSYLAQGYLSMIGLPEEQ KKTMRLMLIMSPVMILFVSMSAPAGLGLYFFVGGLFACLQTLIINFFRPRIRREVEAELK KHPIKTPTPTQPKPINATESKPSHPRPQNNAGRGRNAGKQQRHHK
Uniprot No.

Target Background

Function
Essential for the insertion, proper folding, and complex formation of integral membrane proteins within the membrane. Involved in the integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins.
Database Links

KEGG: lpl:lp_1553

STRING: 220668.lp_1553

Protein Families
OXA1/ALB3/YidC family, Type 2 subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the functional role of YidC1 in Lactobacillus plantarum?

YidC1 functions as a membrane protein insertase that facilitates the integration of proteins into the cytoplasmic membrane of L. plantarum. Based on studies of homologous proteins in related bacterial species, YidC1 is likely essential for proper membrane protein folding and assembly. In Streptococcus mutans, YidC1 and YidC2 have been shown to be essential for bacterial viability . In L. plantarum, membrane protein insertases like YidC1 would be critical for maintaining membrane integrity during environmental stresses encountered in the gastrointestinal tract, as suggested by in vivo expression studies that have identified gut-inducible genes in L. plantarum WCFS1 .

Methodological approach: To investigate YidC1 function in L. plantarum, researchers should consider gene knockout or knockdown experiments followed by phenotypic characterization. Techniques such as RT-PCR can be employed to analyze gene expression patterns under different environmental conditions, similar to methods used for studying L. plantarum gene expression in mouse digestive tracts .

What expression systems are optimal for producing recombinant L. plantarum expressing YidC1?

Based on successful recombinant L. plantarum expression systems, several approaches can be considered:

Recommended expression systems for YidC1:

Expression SystemCharacteristicsApplications
pWCF vector systemSuccessfully used for surface display of antigens in L. plantarumSurface expression of YidC1 for functional studies
NICE (NIsin-Controlled Expression) systemInducible expression with nisinControlled expression for dose-dependent studies
pSIP vectorsInducible expression using sakacin promotersWell-characterized for protein production in L. plantarum

Methodological approach: For YidC1 expression, the pWCF vector system has shown efficacy in L. plantarum as demonstrated with other proteins . This approach involves designing appropriate restriction sites (such as XbaI and HindIII used in other L. plantarum expression studies) to clone the yidC1 gene into the expression vector, followed by electrotransformation into the desired L. plantarum strain .

How can YidC1 expression be verified in recombinant L. plantarum strains?

Multiple complementary approaches should be used to verify successful expression:

  • Immunoblotting: Using specific antibodies against YidC1 or added fusion tags (e.g., His-tag). Bacterial samples can be prepared by either ultrasonic fragmentation or repeated freeze-thaw methods, as demonstrated with other recombinant proteins in L. plantarum .

  • Flow cytometry: For surface-expressed YidC1, flow cytometry with specific antibodies can confirm expression and provide quantitative data on expression levels .

  • Immunofluorescence microscopy: This technique provides visual confirmation of expression and localization. Indirect immunofluorescence analysis with specific antibodies followed by fluorophore-conjugated secondary antibodies (e.g., FITC-conjugated anti-mouse IgG) can be employed .

  • RT-PCR: To verify gene transcription, quantitative RT-PCR using specific primers designed for the yidC1 gene can be performed using methods similar to those described for L. plantarum gene expression studies .

What experimental designs best elucidate YidC1 substrate specificity in L. plantarum?

Determining YidC1 substrate specificity requires systematic approaches:

  • Co-immunoprecipitation coupled with mass spectrometry: This approach can identify proteins that physically interact with YidC1 during membrane insertion.

  • Site-directed mutagenesis: Key residues in YidC1 can be mutated to determine their role in substrate recognition and insertion.

  • Conditional depletion systems: Creating strains with regulatable YidC1 expression allows for identification of proteins whose membrane insertion is compromised when YidC1 levels are reduced.

  • Crosslinking studies: Chemical crosslinking followed by mass spectrometry can capture transient interactions between YidC1 and its substrates.

Methodological considerations: Researchers should design experiments with appropriate controls, including empty vector controls (e.g., NC8Δ-pWCF used as control in recombinant L. plantarum studies) . Statistical analysis using software such as GraphPad Prism with one-way ANOVA can be applied to evaluate significant differences between experimental groups, with significance thresholds at P < 0.05, P < 0.01, P < 0.001, and P < 0.0001 .

How does the in vivo expression of YidC1 vary along the gastrointestinal tract when L. plantarum is administered orally?

Studies of L. plantarum gene expression in the mouse digestive tract provide a framework for investigating YidC1 expression patterns:

  • Sample collection protocol: Following oral administration of L. plantarum strains to laboratory animals (e.g., BALB/c mice), different sections of the digestive tract (duodenum, jejunum, ileum, colon) should be collected and processed for RNA extraction .

  • RNA isolation and RT-PCR analysis: Employ real-time RT-PCR with SYBR green for detection using primers specific for yidC1. Include 16S rRNA as a reference gene for normalization .

  • Primer design considerations: Design primers with melting temperatures of 58-60°C and amplicon sizes between 70-130 bp. Evaluate primer specificity using BLAST and include appropriate controls to detect background contamination and remaining chromosomal DNA .

  • Data analysis: Expression levels can be compared across different intestinal segments and timepoints to create a spatial and temporal expression profile of YidC1.

What methodological approaches effectively evaluate the impact of YidC1 on L. plantarum immunomodulatory properties?

YidC1's role in membrane protein insertion may influence bacterial surface composition and consequently immunomodulatory properties. Based on immunological studies of recombinant L. plantarum:

  • Dendritic cell activation assays: Evaluate the activation of dendritic cells in Peyer's patches following oral administration of wild-type versus YidC1-modified L. plantarum strains .

  • T-cell proliferation and cytokine production: Measure CD4+ and CD8+ T-cell responses, including IFN-γ production, in spleen and mesenteric lymph nodes using flow cytometry .

  • Antibody response analysis: Quantify specific antibody responses (IgG, IgG1, IgG2a, IgA) in serum and fecal samples using ELISA to determine whether YidC1 modifications alter immunogenicity .

  • Mucosal immunity assessment: Use immunofluorescence staining to analyze IgA expression in different intestinal segments (duodenum, jejunum, ileum) and lungs to evaluate effects on mucosal immunity .

Data interpretation framework:

  • Compare YidC1-modified strains with controls using two-way ANOVA

  • Assess statistical significance at P < 0.05, P < 0.01, P < 0.001, and P < 0.0001 levels

  • Use FlowJo software for flow cytometry data analysis and GraphPad Prism for statistical analyses

What strategies can resolve experimental challenges in studying YidC1 membrane topology in L. plantarum?

Membrane protein topology studies present specific challenges that can be addressed through:

  • Reporter fusion approaches: Creating fusions of YidC1 fragments with reporters like PhoA (active in periplasm) or GFP (active in cytoplasm) to map topology.

  • Cysteine accessibility methods: Introducing cysteine residues at various positions and determining their accessibility to membrane-impermeable sulfhydryl reagents.

  • Protease protection assays: Exposing membrane preparations to proteases and identifying protected fragments by mass spectrometry.

  • Cryo-electron microscopy: For high-resolution structural studies of YidC1 in its native membrane environment.

Methodological considerations: When designing topology experiments, researchers should account for potential artifacts introduced by fusion constructs and validate findings using multiple complementary approaches. Controls should include known membrane proteins with established topology patterns.

How can researchers differentiate between the functions of multiple YidC homologs in L. plantarum?

Many bacteria possess multiple YidC homologs with potentially overlapping functions:

  • Individual and combinatorial deletion mutants: Generate single and double knockout strains to identify unique and redundant functions.

  • Complementation studies: Test whether one homolog can complement the loss of another by controlled expression systems.

  • Domain swapping experiments: Create chimeric proteins containing domains from different YidC homologs to identify specificity-determining regions.

  • Transcriptomic and proteomic profiling: Compare the effects of individual homolog deletions on global gene expression and protein profiles to identify specific pathways affected.

  • Stress response testing: Evaluate mutant strains under various stress conditions (pH, temperature, bile salts) to identify condition-specific roles of different homologs.

What approaches best characterize the interaction between YidC1 and the Sec translocon in L. plantarum?

In many bacteria, YidC proteins can function both independently and in conjunction with the Sec translocon:

  • Bacterial two-hybrid systems: Identify direct protein-protein interactions between YidC1 and Sec components.

  • Co-immunoprecipitation studies: Pull down YidC1 and identify associated Sec components by mass spectrometry.

  • Blue native PAGE: Analyze intact membrane protein complexes to identify YidC1-Sec assemblies.

  • Conditional depletion studies: Analyze the effects of SecA or SecY depletion on YidC1-dependent substrate insertion.

  • In vitro reconstitution: Reconstitute purified components in liposomes to study cooperative function in a defined system.

What are the optimal parameters for heterologous expression and purification of L. plantarum YidC1 for structural studies?

Membrane protein structural studies require specialized approaches:

Expression systems comparison:

Expression SystemAdvantagesLimitationsPurification Strategy
E. coli C41/C43 strainsOptimized for membrane protein expressionMay not fold correctlyDDM or LMNG detergent solubilization, IMAC purification
Insect cell systemsBetter folding of complex proteinsHigher cost, longer timeDigitonin solubilization, affinity chromatography
Cell-free systemsDirect incorporation into nanodiscs or liposomesLower yieldsDirect purification via affinity tags

Methodological considerations: Successful structural studies of membrane proteins require screening multiple constructs with various affinity tags, optimizing solubilization conditions with different detergents, and employing techniques like SEC-MALS to verify monodispersity. For crystallization attempts, use of stabilizing antibody fragments or nanobodies may improve success rates.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.