Recombinant Lactobacillus plantarum Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference for your use.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
lgt; lp_0755; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-282
Protein Length
full length protein
Species
Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Target Names
lgt
Target Protein Sequence
MNTVLGALNPIALRLGPIQVHWYGVIIASAVVIAVALAVREGQRRGVRPDDIYDMILWAL PFTLIAARTYYVIFQWSYYRQNPGEIIRIWDGGIAIYGGLIGAGIVVILFCRSRFIPTWL MLDIAAPTVIMGQGIGRWGNFMNQEAFGRVTSLSFLQGLHLPDWLINQMYIRGAYRQPTF LYESVWDLLGFALLMLTRHRTHWYKQGDVFLTYVAWYAFGRFFTEGMRTDSLMLFNVIRV SQALSVVLFFGSIGLMIWRRHHNPNNRWYLAGSGQKVVAENK
Uniprot No.

Target Background

Function
Catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links

KEGG: lpl:lp_0755

STRING: 220668.lp_0755

Protein Families
Lgt family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Lactobacillus plantarum and why is it significant in probiotic research?

Lactiplantibacillus plantarum (formerly known as Lactobacillus plantarum) is a versatile probiotic bacterium found in the mouth, gut, and fermented foods. It possesses several characteristics that make it an ideal model organism for probiotic research:

  • It has one of the largest genomes among lactic acid bacteria, demonstrating significant intraspecific versatility

  • L. plantarum is adaptable to multiple environments and can temporarily persist in plants, insect intestines, and vertebrate gastrointestinal tracts, earning it the designation of a "nomadic organism"

  • It can grow in a wide pH range (3.4-8.8) and temperature range (12-40°C)

  • L. plantarum has well-documented anti-inflammatory and immunomodulatory properties

The strain L. plantarum WCFS1 is particularly valuable as a probiotic model organism due to its well-characterized genome and established roles in host-microbe interactions .

What is prolipoprotein diacylglyceryl transferase (lgt) and what functions does it serve?

Prolipoprotein diacylglyceryl transferase (lgt) is an enzyme responsible for the lipidation of lipoprotein precursors in bacteria. Its key functions include:

  • Catalyzing the transfer of diacylglyceryl groups to lipoprotein precursors, which is essential for proper anchoring of lipoproteins in the cell membrane

  • Contributing to the formation of mature bacterial lipoproteins that serve as microorganism-associated molecular patterns (MAMPs)

  • Enabling proper lipoprotein interactions with Toll-like receptor 2 (TLR2), an important pattern recognition receptor of the host innate immune system

When the lgt gene is deleted, bacteria produce non-acylated lipoproteins that are released into the extracellular environment rather than being properly anchored to the cell membrane .

How do lipoproteins contribute to L. plantarum's immunomodulatory properties?

Lipoproteins play a critical role in the immunomodulatory capabilities of L. plantarum through several mechanisms:

  • They function as microorganism-associated molecular patterns (MAMPs) that interact with TLR2 receptors on host immune cells

  • The acyl chains of lipoproteins are essential for appropriate TLR2 signaling and subsequent immune response modulation

  • Research demonstrates that lipoproteins in L. plantarum WCFS1 are critical drivers of anti-inflammatory host responses

  • When the lgt gene is deleted, resulting in non-acylated lipoproteins, the mutant bacteria show significantly altered immune stimulation profiles compared to wild-type strains

Studies have shown that the immunomodulatory effects of L. plantarum lipoproteins are distinct from those of pathogenic bacteria, providing valuable insights into the mechanisms of probiotic-host interactions .

What experimental models are commonly used to study L. plantarum-host interactions?

Several experimental models are frequently employed to investigate L. plantarum interactions with host cells:

Experimental ModelApplicationAdvantages
Reporter cell linesTLR2 signaling assaysHigh sensitivity to detect lipoprotein-TLR2 interactions
Intestinal epithelial cell cultures (e.g., IPEC-J2)Adhesion and invasion studiesModels intestinal barrier interactions
Bone marrow-derived dendritic cellsImmune cell differentiation and cytokine productionReveals mechanisms of adaptive immunity activation
Animal models (mouse, goose)In vivo validationProvides systemic responses in complete organisms

These models are often used in combination to provide comprehensive data on how L. plantarum interacts with host systems .

What methodologies are most effective for analyzing the impact of lgt mutation on the secreted proteome of L. plantarum?

Comprehensive proteomics approaches have proven effective for analyzing how lgt mutation affects the L. plantarum secretome:

  • Sample preparation protocol: Culture L. plantarum WCFS1 wild-type and Δlgt strains to OD600 of approximately 5 in 100 mL of 2xCDM, filter supernatants through hydrophilic PVDF filters (0.22 μm pore size), and precipitate proteins using trichloroacetic acid (16% final concentration) with overnight incubation at 4°C

  • Protein analysis workflow:

    • Pellet precipitated proteins by centrifugation at 16,000 × g

    • Perform liquid chromatography-mass spectrometry (LC-MS/MS) analysis

    • Analyze data using MaxQuant algorithm for label-free quantitation (LFQ)

    • Calculate relative abundances as the ratio of LFQ of detected peptides in wild-type and lgt mutant and present in log10 values

  • Database utilization: Use strain-specific protein databases (e.g., L. plantarum ATCC BAA-793/NCIMB 8826/WCFS1 from UniProt) along with common contaminant sequences (trypsin, keratins) to ensure accurate protein identification

This methodology can effectively identify lipoproteins released in non-acylated form in the lgt mutant compared to the wild-type strain.

How does lipoprotein acylation specifically contribute to TLR2 signaling and anti-inflammatory responses?

The acylation of lipoproteins through lgt activity has profound effects on TLR2 signaling and resulting inflammatory responses:

  • Acylation is essential for appropriate anchoring in the bacterial cell membrane as well as for interaction with TLR2 receptors on host cells

  • Studies comparing wild-type L. plantarum and lgt mutants reveal that properly acylated lipoproteins are required for optimal TLR2 activation

  • The acyl chains (di- or tri-acyl forms) serve as molecular patterns recognized by TLR2-TLR1 or TLR2-TLR6 heterodimers on host cells, triggering specific signaling cascades

  • Experimental data show that L. plantarum with intact lgt function modulates cytokine expression in macrophages, with significant differences in IL-6, TNF-α, IL-15, IL-18bp, IL-1β, and IL-12b compared to controls

Researchers can assess these effects using reporter cell-based models specifically designed to measure TLR2 signaling or by analyzing cytokine production profiles in immune cells exposed to wild-type versus lgt-mutant bacteria .

What challenges exist in engineering recombinant L. plantarum strains with modified lgt for enhanced immunomodulatory properties?

Engineering recombinant L. plantarum strains with modified lgt presents several technical challenges:

  • Genetic manipulation complexity: The essential nature of many lipoproteins for bacterial viability limits how extensively lgt can be modified without compromising bacterial fitness

  • Expression system selection: Researchers must carefully select appropriate promoters and expression systems that function efficiently in L. plantarum, as heterologous expression systems optimized for other bacteria may not work effectively

  • Verification of modifications: Confirming successful genetic modifications requires rigorous verification through:

    • PCR and gene sequencing

    • Functional assays of lgt activity

    • Proteomic analysis to confirm altered lipoprotein profiles

    • Phenotypic assessment of growth, stress resistance, and other physiological parameters

  • Stability considerations: Engineered modifications must remain stable through multiple generations for reliable experimental and potential therapeutic applications

A promising approach involves recombinant L. plantarum engineered to express heterologous proteins that enhance its immunomodulatory properties. For example, L. plantarum strains expressing fibronectin binding protein A (FnBPA) show approximately two-fold increased adhesion and invasion ratios on intestinal epithelial cells, enhancing their potential as vaccine delivery vehicles .

What are the most effective experimental designs for evaluating specific lipoprotein functions in L. plantarum?

Robust experimental designs for evaluating specific lipoprotein functions should include:

Genetic approaches:

  • Gene deletion studies: Target specific lipoprotein genes or the lgt gene itself

  • Heterologous expression: Express specific lipoproteins in controlled systems to assess their individual functions

  • Complementation studies: Reintroduce modified genes to confirm phenotype reversibility

Functional assessments:

  • TLR2 activation assays using reporter cell lines

  • Cytokine profiling in immune cells using ELISA, flow cytometry, and qRT-PCR

  • Adhesion and invasion assays with intestinal epithelial cell models

In vivo validation:

  • Animal models with specific readouts for immune activation:

    • Analysis of dendritic cell differentiation in Peyer's patches

    • Assessment of T helper cell populations in the spleen

    • Measurement of specific antibody production (e.g., IgG, sIgA)

A comprehensive experimental design should combine these approaches to provide complementary lines of evidence for lipoprotein functions.

How can researchers differentiate between lipoprotein-specific effects and other bacterial components in host immune responses?

Differentiating lipoprotein-specific effects from other bacterial components requires multiple complementary approaches:

  • Isogenic mutant comparisons: Generate and compare wild-type, lgt mutant, and complemented strains to isolate lipoprotein-specific effects

  • Purified component testing: Extract and purify specific bacterial components to test individually:

    • Purified lipoproteins from wild-type bacteria

    • Non-acylated lipoproteins from lgt mutants

    • Cell wall components

    • Secreted metabolites

  • Receptor blocking studies: Use TLR2-blocking antibodies or TLR2-deficient cell lines to confirm the role of this receptor in lipoprotein recognition

  • Comparative genomics and transcriptomics: Compare the genomic content and expression patterns of different L. plantarum strains with varying immunomodulatory capacities to identify potential lipoprotein candidates responsible for specific effects

To illustrate the complexity of these interactions, studies have revealed that L. plantarum strains can differentially modulate gene expression in macrophages, with distinct patterns observed for genes related to cytokines and chemokines (CSF2, IL-6, TNF-α, IL-15, IL-18bp, IL-1β, and IL-12b) .

What are the current limitations in understanding the structure-function relationships of L. plantarum lipoproteins?

Despite significant advances, several limitations exist in our understanding of L. plantarum lipoprotein structure-function relationships:

  • Structural diversity: The diverse structural features of lipoproteins in L. plantarum make it challenging to establish clear structure-function correlations

  • Post-translational modifications: Beyond Lgt-mediated lipidation, other post-translational modifications may affect lipoprotein function but remain poorly characterized

  • Receptor specificity: The precise molecular interactions between specific lipoproteins and TLR2 (or other receptors) remain incompletely defined

  • Strain variation: Different L. plantarum strains may produce lipoproteins with varying structures and functions, complicating generalization across the species

  • Methodological limitations: Current proteomic techniques may not detect all lipoproteins, particularly those expressed at low levels or with unusual modifications

Addressing these limitations requires advanced structural biology approaches combined with functional studies to better correlate specific lipoprotein structural features with their immunomodulatory effects.

How can findings from L. plantarum lgt research be applied to develop novel probiotic formulations?

Research on L. plantarum lgt has several promising applications for developing next-generation probiotics:

  • Enhanced immunomodulatory strains: Engineering L. plantarum strains with optimized lipoprotein profiles could enhance their anti-inflammatory properties for conditions like irritable bowel syndrome, ulcerative colitis, and other inflammatory disorders

  • Targeted delivery vehicles: L. plantarum strains with modified surfaces could serve as delivery vehicles for vaccines or therapeutic proteins to mucosal surfaces

  • Synergistic formulations: Combining different L. plantarum strains with complementary lipoprotein profiles might provide synergistic immunomodulatory effects

  • Precision probiotics: Matching specific L. plantarum strains to individual patients based on their immune profiles could optimize therapeutic outcomes

For example, recombinant L. plantarum expressing fibronectin binding protein A (FnBPA) shows promise as a vaccine delivery vehicle, with improved adhesion to epithelial cells and enhanced stimulation of dendritic cell differentiation .

What are the most promising future research directions in L. plantarum lipoprotein biology?

Several promising research directions could advance our understanding of L. plantarum lipoprotein biology:

These research directions could significantly advance our understanding of how L. plantarum lipoproteins contribute to probiotic effects and potentially lead to novel therapeutic applications.

What are the key considerations when designing gene knockout studies targeting lgt in L. plantarum?

Designing effective gene knockout studies targeting lgt in L. plantarum requires careful attention to several factors:

  • Knockout strategy selection: Choose appropriate methods such as homologous recombination, CRISPR-Cas9, or transposon mutagenesis based on efficiency and specificity requirements

  • Confirmation protocols: Verify successful gene deletion through multiple methods:

    • PCR verification of the targeted genomic region

    • Whole genome sequencing to confirm the absence of unwanted mutations

    • Proteomic analysis to confirm altered lipoprotein profiles

  • Control strains: Develop appropriate control strains including:

    • Wild-type parent strain

    • Complemented mutant strains to verify phenotype reversibility

    • Strains with mutations in related but distinct genes to demonstrate specificity

  • Growth conditions: Carefully standardize growth conditions as lgt mutation may affect bacterial fitness under certain conditions

  • Phenotypic analysis: Comprehensively assess mutant phenotypes including growth kinetics, stress resistance, and cell morphology before proceeding to host interaction studies

A well-designed knockout study should account for potential pleiotrophic effects that might confound interpretation of results specifically related to lipoprotein function.

How should researchers optimize protocols for analyzing L. plantarum immunomodulatory effects?

Optimizing protocols for analyzing L. plantarum immunomodulatory effects requires:

Cell culture considerations:

  • Select appropriate cell models (intestinal epithelial cells, dendritic cells, macrophages) that reflect relevant physiological interactions

  • Standardize bacteria-to-cell ratios, typically ranging from 1:1 to 100:1 depending on the assay

  • Control for bacterial viability and growth phase which can significantly impact immunomodulatory properties

Immune response measurements:

  • Employ complementary techniques for cytokine analysis:

    • ELISA for protein quantification

    • qRT-PCR for mRNA expression

    • Flow cytometry for cellular phenotyping

  • Include appropriate positive controls (e.g., LPS for TLR4, Pam3CSK4 for TLR2)

  • Assess both pro-inflammatory (TNF-α, IL-6, IL-1β) and anti-inflammatory (IL-10) markers

Data analysis approaches:

  • Use multivariate analysis to comprehensively evaluate immunomodulatory profiles rather than focusing on individual markers

  • Consider time-dependent effects by measuring responses at multiple time points post-exposure

  • Compare results across different L. plantarum strains to distinguish strain-specific from species-common effects

These optimized protocols enable more reliable and reproducible assessment of L. plantarum's immunomodulatory properties.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.