Recombinant Lactobacillus plantarum Protein CrcB homolog 1 (crcB1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
crcB1; lp_0213; Putative fluoride ion transporter CrcB 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-116
Protein Length
full length protein
Species
Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Target Names
crcB1
Target Protein Sequence
MLVLVGLAGAGAAVGALSRYGIMRLALPLNRWPLPIATLFINLTGALLLGWILTSSLPPN WQIFLGTGIMGGYTTFSTMINELVLLGRNHHQRVAWEYFGLSLVGGLVMVYLGTLI
Uniprot No.

Target Background

Function
Crucial for reducing intracellular fluoride concentration and its associated toxicity.
Database Links

KEGG: lpl:lp_0213

STRING: 220668.lp_0213

Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Lactobacillus plantarum and why is it suitable for recombinant protein expression?

Lactobacillus plantarum is a versatile lactic acid bacterium found in various environmental niches with proven ability to survive gastric transit and colonize the intestinal tract of humans and other mammals. Its complete genome sequencing (L. plantarum WCFS1) makes it a suitable model for exploring molecular mechanisms underlying targeted intestinal properties . The bacterium's ability to survive in the gastrointestinal environment (with survival rates of 7±2% in the human ileum compared to only 1±0.8% for Lactococcus lactis) makes it particularly valuable for recombinant protein expression systems where in vivo functionality is desired .

What is CrcB homolog 1 (crcB1) and what is its putative function in L. plantarum?

CrcB homolog 1 (crcB1) is predicted to encode a membrane protein involved in ion channel regulation, particularly fluoride resistance. While the search results don't explicitly mention crcB1, the general framework for studying recombinant proteins in L. plantarum involves understanding gene function through molecular approaches such as promoter screens, Recombinase-based In Vivo Expression Technology (R-IVET), and DNA microarrays . Basic studies of crcB1 would likely focus on its role in bacterial stress responses and membrane transport functions.

What expression systems are available for recombinant protein production in L. plantarum?

Expression systems for L. plantarum typically involve plasmid vectors with specific promoters. As demonstrated in the search results, researchers can construct recombinant L. plantarum strains using techniques such as the pWCF vector system . The basic methodology involves:

  • Gene synthesis or PCR amplification of the target gene (such as crcB1)

  • Restriction digestion and ligation into expression vectors

  • Electrotransformation into L. plantarum host cells

  • Selection and verification of positive recombinants through restriction analysis and immunoblotting

How can I optimize codon usage for efficient expression of crcB1 in L. plantarum?

For optimal expression of crcB1 in L. plantarum, codon optimization should account for the organism's codon bias. While not specifically mentioned for crcB1, the approach used for other recombinant proteins in L. plantarum involves gene synthesis with optimized codons. The methodology would include:

  • Analysis of codon usage frequency in highly expressed L. plantarum genes

  • Adjustment of rare codons in the crcB1 sequence to match L. plantarum preferences

  • Removal of potential regulatory sequences that might interfere with expression

  • Incorporation of appropriate restriction sites for subsequent cloning steps

This approach enhances protein yield, as demonstrated in the construction of recombinant L. plantarum expressing viral antigens .

What strategies can be employed to enhance the immunogenicity of recombinant L. plantarum expressing crcB1?

To enhance immunogenicity of recombinant L. plantarum expressing crcB1, researchers can employ strategies similar to those used with the HA1 antigen. The methodology includes:

  • Fusion with immunostimulatory molecules or adjuvants such as dendritic cell-targeting peptide (DCpep)

  • Tandem linking of the target protein with three DCpep peptides as demonstrated for HA1

  • Construction of vectors containing crcB1 with and without adjuvant peptides for comparative analysis

  • Verification of fusion protein expression using immunoblotting techniques

These approaches can significantly increase immune responses as seen with other recombinant L. plantarum strains, potentially activating dendritic cells in Peyer's patches and increasing specific immune cell populations .

What are the key considerations for designing in vivo studies to evaluate the function of recombinant L. plantarum expressing crcB1?

When designing in vivo studies for evaluating recombinant L. plantarum expressing crcB1, researchers should consider:

  • Selection of appropriate animal models (mice are commonly used as demonstrated in the HA1 studies)

  • Determination of optimal dosage and administration route (oral administration is typically used for L. plantarum)

  • Establishment of appropriate sampling timepoints and locations (intestinal segments, Peyer's patches, mesenteric lymph nodes)

  • Comprehensive evaluation of both local and systemic responses:

    • Cellular activation in Peyer's patches

    • Cell proliferation in spleen and mesenteric lymph nodes

    • Antibody production in serum and mucosal secretions

    • Functional assays specific to crcB1's expected biological activity

How can I confirm the successful expression of recombinant crcB1 in L. plantarum?

To confirm successful expression of recombinant crcB1 in L. plantarum, employ multiple complementary techniques:

  • Immunoblotting analysis:

    • Sonicate or freeze-thaw bacterial cells to release proteins

    • Separate proteins by SDS-PAGE and transfer to membranes

    • Probe with specific antibodies against crcB1 or added tags

    • Include appropriate controls (e.g., NC8Δ-pWCF without insert)

  • Flow cytometry analysis:

    • Use specific antibodies against crcB1 or added tags

    • Apply fluorescently-labeled secondary antibodies

    • Analyze cell populations to quantify expression levels

  • Indirect immunofluorescence:

    • Fix bacterial cells on slides

    • Probe with specific primary antibodies

    • Visualize using fluorescently-labeled secondary antibodies

    • Examine under fluorescence microscopy

These methods provide complementary information about expression levels, localization, and integrity of the recombinant protein.

What purification strategies are most effective for isolating recombinant crcB1 from L. plantarum?

For effective purification of recombinant crcB1 from L. plantarum, consider:

  • Membrane protein extraction protocols:

    • Cell disruption using sonication or high-pressure homogenization

    • Differential centrifugation to isolate membrane fractions

    • Detergent solubilization (e.g., n-dodecyl-β-D-maltoside or Triton X-100)

    • Affinity chromatography if tags were incorporated

  • Tag-based purification approaches:

    • Incorporation of purification tags (His-tag, FLAG-tag) during vector construction

    • Immobilized metal affinity chromatography for His-tagged proteins

    • Anti-tag antibody affinity chromatography

    • Size exclusion chromatography for final polishing

  • Activity-based purification:

    • Ion exchange chromatography based on crcB1's predicted charge properties

    • Specific binding assays if ligands are known

    • Functional assays to verify purified protein activity

How can I assess the ion channel function of purified recombinant crcB1?

To assess ion channel function of purified recombinant crcB1:

  • Electrophysiological techniques:

    • Reconstitution of purified crcB1 into lipid bilayers

    • Patch-clamp recordings to measure ion conductance

    • Ion selectivity determination using ion gradient experiments

  • Fluorescence-based assays:

    • Reconstitution of crcB1 into liposomes loaded with ion-sensitive fluorescent dyes

    • Measurement of ion flux upon addition of potential substrates

    • Competition assays with known ion channel inhibitors

  • Bacterial growth assays:

    • Complementation of fluoride-sensitive bacterial strains with crcB1

    • Growth inhibition assays in the presence of varying fluoride concentrations

    • Comparison of wild-type and mutant crcB1 variants

What approaches can be used to study the interaction between crcB1 and host immunity when expressed in recombinant L. plantarum?

To study interactions between crcB1-expressing L. plantarum and host immunity:

  • Dendritic cell activation analysis:

    • Isolation of dendritic cells from Peyer's patches

    • Flow cytometry assessment of activation markers (CD80, CD86, MHC-II)

    • Cytokine profiling of activated dendritic cells

  • T cell response evaluation:

    • Quantification of CD4+ and CD8+ T cell populations in spleen and mesenteric lymph nodes

    • Assessment of IFN-γ production by T cells

    • T cell proliferation assays following exposure to recombinant L. plantarum

  • B cell and antibody response measurement:

    • Quantification of B220+IgA+ cells in Peyer's patches

    • ELISA assays for specific antibody production

    • Analysis of antibody isotypes (IgG, IgG1, IgG2a, IgA) in serum and mucosal secretions

What are potential challenges in achieving stable expression of crcB1 in L. plantarum and how can they be addressed?

Common challenges and solutions for stable crcB1 expression include:

ChallengePotential SolutionMethodology
Low expression levelsOptimize codon usageSynthetic gene design with L. plantarum-preferred codons
Modify promoter strengthTest different promoter sequences
Adjust culture conditionsOptimize temperature, pH, and induction parameters
Protein toxicityUse inducible expression systemsIncorporate regulated promoters with tight control
Express as fusion with solubility partnersAdd solubility tags like thioredoxin or SUMO
Plasmid instabilityIncorporate selection pressureMaintain antibiotic selection throughout culture
Use chromosomal integrationDevelop integration vectors for single-copy stable expression
Incorrect protein foldingCo-express chaperonesAdd L. plantarum-specific chaperone genes to expression system
Optimize growth temperatureLower temperature to slow folding process

How can I interpret contradictory results between in vitro and in vivo studies of recombinant L. plantarum expressing crcB1?

When faced with contradictory results between in vitro and in vivo studies:

  • Consider physiological context differences:

    • In vivo environmental factors (pH, oxygen levels, competing microbiota)

    • Host-specific factors (immune responses, intestinal transit time)

    • The presence of intestinal mucus and epithelial barriers

  • Examine strain variability:

    • Plasmid stability and expression levels in different environments

    • Differential gene regulation under laboratory versus gastrointestinal conditions

    • Potential differences in post-translational modifications

  • Evaluate sampling and detection methodologies:

    • Sensitivity differences between in vitro and in vivo detection methods

    • Timing of sampling relative to bacterial transit (L. plantarum shows variable transit times in human subjects)

    • Presence of interfering substances in in vivo samples

  • Design bridging studies:

    • Ex vivo organ cultures to bridge in vitro and in vivo findings

    • Gnotobiotic animal models to control for microbiota variables

    • Stepped complexity experiments progressing from simple to complex systems

What potential exists for using recombinant L. plantarum expressing crcB1 as a biotherapeutic agent?

The potential for recombinant L. plantarum expressing crcB1 as a biotherapeutic agent builds upon L. plantarum's established properties:

  • Demonstrated ability to colonize the human intestinal tract:

    • L. plantarum shows 7±2% survival in the human ileum, significantly higher than other lactic acid bacteria

    • Approximately two-thirds of L. plantarum isolates from humans demonstrate mannose-inhibited adherence to human colonic cells, suggesting permanent colonization potential

  • Proven safety profile:

    • L. plantarum is generally recognized as safe and shows apparent safety in human consumption studies

    • Already used in multiple clinical trials with no significant adverse effects reported

  • Potential delivery mechanisms:

    • Oral administration with demonstrated efficacy in inducing immune responses

    • Targeted delivery to intestinal segments where crcB1 function may be most beneficial

    • Potential for engineering controlled release through environmentally responsive promoters

  • Regulatory and development considerations:

    • Need for comprehensive safety assessments of the recombinant construct

    • Stability testing under various storage conditions

    • Efficacy evaluations in appropriate disease models

How could genome-wide approaches enhance our understanding of crcB1 function in recombinant L. plantarum?

Genome-wide approaches to enhance understanding of crcB1 function include:

  • Transcriptomic analysis:

    • RNA-seq comparison of wild-type versus crcB1-overexpressing L. plantarum

    • Identification of genes co-regulated with crcB1 under various stress conditions

    • Analysis of transcriptional changes in host cells exposed to recombinant L. plantarum

  • Proteomic approaches:

    • Quantitative proteomics to identify protein interaction networks

    • Phosphoproteomics to detect signaling pathways affected by crcB1 expression

    • Membrane proteome analysis to understand integration into bacterial membrane complexes

  • Systems biology integration:

    • Metabolomic profiling to detect changes in bacterial and host metabolism

    • Integration of multi-omics data to build comprehensive interaction models

    • Network analysis to predict secondary effects of crcB1 modulation

  • Comparative genomics:

    • Analysis of crcB homologs across different bacterial species

    • Identification of conserved regulatory elements and protein domains

    • Evolutionary analysis to understand selective pressures on crcB genes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.