Recombinant Lactobacillus plantarum Putative AgrB-like protein (lp_3582)

What is the Lactobacillus plantarum Putative AgrB-like protein (lp_3582)?

The AgrB-like protein (lp_3582) is part of an agr-like two-component regulatory system in Lactobacillus plantarum, designated as the Lactobacillus agr-like module (lam). This protein shows homology to the staphylococcal agr quorum-sensing system. The full-length protein consists of 200 amino acids with the sequence: MEKPEQKLLLYKLSDRLFAAIQKNLQLERRQALLVKLGIDTVLNVIPKLIITIILALLLHELVPVLVFMGSFLVLRGFAYGRHLESDLLCTILTAVTFVGVPYLIQFTDGIPELFRFILCLLLTVPIGMFSPAVTRKNPIKSQSLKRALKHKAIITSLVFSFLQFLVSNNLGTIIVVSLLLVFTLIVPLKGGKSDEAENV . The protein is part of a system that represents the first example of an agr-like system in nonpathogenic bacteria that encodes a cyclic thiolactone autoinducing peptide and is involved in regulating adherence .

What is the functional role of the lamBDCA system in Lactobacillus plantarum?

The lamBDCA system in L. plantarum functions as a quorum-sensing mechanism that regulates adherence to surfaces. Research has demonstrated that lamBDCA transcript production is growth phase dependent. Analysis of a response regulator-defective mutant (ΔlamA) showed that this system regulates adherence of L. plantarum to glass surfaces . Global transcription analysis confirmed that lamBDCA is autoregulatory and revealed that lamA is involved in regulating expression of genes encoding surface polysaccharides, cell membrane proteins, and sugar utilization proteins . This system plays a crucial role in bacterial communication and adaptation to environmental conditions.

How is recombinant lp_3582 protein typically produced for research purposes?

The recombinant full-length L. plantarum putative AgrB-like protein (lp_3582) is typically produced by expression in E. coli systems. According to available product information, the protein is fused to an N-terminal His tag to facilitate purification . After expression and purification, the protein is typically provided as a lyophilized powder. For research use, this powder should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL, potentially with 5-50% glycerol added for long-term storage stability . The protein preparation typically demonstrates purity greater than 90% as determined by SDS-PAGE analysis.

What is the relationship between lp_3582 and the autoinducing peptide identified in L. plantarum?

The lp_3582 protein (LamB) is believed to be involved in processing the autoinducing peptide precursor (LamD) in the L. plantarum quorum-sensing system. Research has identified a cyclic thiolactone pentapeptide, designated LamD558, with the sequence CVGIW . This peptide possesses a ring structure similar to those of autoinducing peptides found in the staphylococcal agr system. Time course analysis of wild-type culture supernatants by LC/MS indicated that LamD558 production increased markedly from mid-log to late log growth phase . This temporal pattern suggests a growth phase-dependent regulation mechanism coordinated by the lamBDCA system, with lp_3582 playing a crucial processing role in the signaling pathway.

How does the structure of lp_3582 relate to its peptide processing function?

The structure-function relationship of lp_3582 can be understood through analysis of its predicted domains and their roles:

The protein's amino acid sequence (MEKPEQKLLLYKLSDRLFAAIQKNLQLERRQALLVKLGIDTVLNVIPKLIITIILALLLHELVPVLVFMGSFLVLRGFAYGRHLESDLLCTILTAVTFVGVPYLIQFTDGIPELFRFILCLLLTVPIGMFSPAVTRKNPIKSQSLKRALKHKAIITSLVFSFLQFLVSNNLGTIIVVSLLLVFTLIVPLKGGKSDEAENV) suggests multiple transmembrane domains, consistent with its role in processing peptides at the cell membrane interface . The specific catalytic residues involved in thiolactone ring formation remain to be fully characterized through targeted mutagenesis studies.

What methods are most effective for studying the localization and expression patterns of lp_3582?

To effectively study lp_3582 localization and expression patterns, researchers should employ a multi-method approach:

• Transcriptional analysis:

  • Quantitative RT-PCR to measure transcript levels across growth phases

  • RNA-seq for genome-wide expression context

  • Promoter-reporter fusions to visualize expression in real-time

• Protein localization:

  • Fluorescent protein fusions (ensuring function is preserved)

  • Immunolocalization with specific antibodies

  • Membrane fractionation followed by Western blot analysis

• Expression dynamics:

  • Time-course sampling from early exponential to stationary phase

  • Growth in different media compositions to assess environmental effects

  • Co-culture experiments to evaluate interspecies effects

Time course analysis has already revealed that LamD558 production increases markedly from mid-log to late log growth phase , suggesting that expression studies should focus particularly on these transition periods for maximum insight.

What expression systems yield the highest quality recombinant lp_3582 protein?

The optimal expression systems for producing high-quality recombinant lp_3582 can be evaluated through comparative analysis:

Based on available information, expression in E. coli with N-terminal His-tagging has been successfully used , though lower temperatures and specialized strains designed for membrane protein expression would likely improve functional yield. The pSIP-409 inducible vector system has proven effective for expressing recombinant proteins in Lactobacillus plantarum , potentially offering a more native-like environment for proper folding and function.

What are the critical parameters for successful reconstitution of lyophilized lp_3582?

Successful reconstitution of lyophilized lp_3582 protein requires careful attention to several parameters:

• Initial preparation:

  • Brief centrifugation of the vial prior to opening to bring contents to the bottom

  • Use of deionized sterile water as the primary reconstitution agent

• Concentration considerations:

  • Reconstitution to 0.1-1.0 mg/mL for optimal stability

  • Addition of glycerol (5-50% final concentration) for cryoprotection

• Storage conditions:

  • Aliquoting to avoid repeated freeze-thaw cycles

  • Storage at -20°C/-80°C for long-term preservation

  • Working aliquots may be maintained at 4°C for up to one week

• Buffer composition:

  • Tris/PBS-based buffer with 6% Trehalose, pH 8.0 has been determined effective

  • Avoiding repeated freeze-thaw cycles is crucial for maintaining protein integrity

These parameters ensure maximum retention of structural integrity and functional activity for subsequent experimental applications.

How can researchers evaluate the biological activity of purified recombinant lp_3582?

Evaluating the biological activity of purified recombinant lp_3582 requires multiple complementary approaches:

• Peptide processing assays:

  • Incubation with synthetic LamD precursor peptides

  • LC/MS analysis to detect conversion to cyclic thiolactone form

  • Kinetic measurements of processing efficiency

• Functional complementation:

  • Introduction into lamB-deficient mutants

  • Restoration of adherence phenotypes

  • Recovery of growth phase-dependent signaling

• Structural integrity assessment:

  • Circular dichroism to confirm secondary structure elements

  • Thermal shift assays to evaluate stability

  • Limited proteolysis to verify proper folding

• Interaction studies:

  • Pull-down assays with other Lam system components

  • Surface plasmon resonance to measure binding kinetics

  • Cross-linking experiments to capture transient interactions

These methods collectively provide a comprehensive evaluation of whether the recombinant protein maintains its native peptide processing and regulatory functions.

How does lp_3582 contribute to the probiotic potential of Lactobacillus plantarum strains?

The contribution of lp_3582 to probiotic potential lies in its regulatory role within the lamBDCA system, which influences critical probiotic-associated functions:

• Adherence regulation:

  • The lamBDCA system has been demonstrated to regulate adherence to surfaces

  • Proper adherence is essential for colonization and persistence in the gut environment

  • Surface properties influenced by this system may affect interactions with host epithelial cells

• Biofilm formation:

  • Adherence regulation directly impacts biofilm development

  • Biofilms contribute to probiotic persistence and colonization resistance against pathogens

  • The lamBDCA system's regulation of surface polysaccharides affects biofilm architecture

• Strain-specific probiotic traits:

  • Research has identified specific L. plantarum strains (such as ZS07 and K21) with strong probiotic potential

  • These strains demonstrate characteristics like antibacterial activity and acid resistance

  • The lamBDCA system may contribute to these strain-specific properties through regulation of cell surface components

Understanding the lp_3582 protein's role in these processes could potentially enable the development of enhanced probiotic strains with improved adherence, persistence, and host interaction capabilities.

What is the relationship between lp_3582 function and immunomodulatory effects of L. plantarum?

The potential relationship between lp_3582 function and immunomodulatory effects of L. plantarum represents an emerging area of investigation:

• Surface component regulation:

  • The lamBDCA system regulates expression of surface polysaccharides and cell membrane proteins

  • These surface components are known to interact with host immune receptors

  • Different L. plantarum strains demonstrate varied effects on human dendritic and peripheral blood mononuclear cells

• Strain-specific immune responses:

  • L. plantarum strains show differential activation of TLR2-4 and CD14 antigens

  • These differences result in varied production of pro-inflammatory cytokine IL-12 and regulatory cytokine IL-10

  • Genomic comparison has identified cell wall components involved in glycosylation of teichoic acids associated with these differential effects

• Potential signaling mechanisms:

  • The cyclic thiolactone peptide LamD558 processed by lp_3582 might interact directly or indirectly with host cells

  • Quorum sensing molecules from some bacteria have been shown to influence host immune responses

  • The growth phase-dependent production of these signaling molecules may coordinate bacterial responses to host immune status

Research with specific L. plantarum strains has demonstrated effects on systemic and gut mucosal immunity, including impacts on regulatory T cells and memory responses against antigens . The contribution of lp_3582 to these effects warrants further investigation.

How might genetic engineering of lp_3582 enhance therapeutic applications of L. plantarum?

Genetic engineering of lp_3582 presents several promising avenues for enhancing therapeutic applications:

• Expression optimization:

  • Modifying expression levels to enhance signaling efficiency

  • Creating constitutive variants for continuous production of regulatory signals

  • Engineering inducible systems responding to specific host environments

• Substrate specificity modification:

  • Altering the protein to process novel signaling peptides

  • Engineering chimeric proteins with modified domain architecture

  • Creating variants with broader or narrower substrate specificity

• Integration with therapeutic peptide delivery:

  • L. plantarum has demonstrated potential for expressing therapeutic peptides, such as those with antihypertensive effects

  • The lamBDCA system could be engineered to regulate expression of these therapeutic molecules

  • Coordinating therapeutic production with colonization and adherence properties

• Enhanced strain stability:

  • Optimizing the system for improved persistence in therapeutic applications

  • Engineering variants with increased stress resistance for survival in manufacturing and GI transit

  • Creating robust regulatory circuits that maintain therapeutic efficacy under variable conditions

Recombinant L. plantarum has already shown promise in therapeutic applications, such as the treatment of hypertension through expression of angiotensin-converting enzyme inhibitory peptides . Engineering lp_3582 could further enhance these capabilities by improving colonization, persistence, and targeted therapeutic molecule delivery.

How do environmental factors influence the function of lp_3582 in quorum sensing?

The influence of environmental factors on lp_3582 function in quorum sensing represents a critical area for research using the following methodological approaches:

• Transcriptional response analysis:

  • RNA-seq or microarray analysis under varied environmental conditions

  • Identification of environmental stress response elements in lamBDCA promoter regions

  • Reporter gene fusions to monitor real-time expression changes

• Environmental variables to investigate:

  • pH fluctuations typical of GI transit (pH 2-7)

  • Oxygen tension variations (aerobic, microaerobic, anaerobic)

  • Nutrient availability and carbon source diversity

  • Bile salt concentrations and osmotic stress

  • Polymicrobial community effects

• Signaling molecule production analysis:

  • LC/MS quantification of LamD558 under different conditions

  • Correlation between environmental stressors and signaling molecule concentration

  • Kinetic studies of peptide processing efficiency in response to environmental variables

Production of the lamBDCA transcript has been shown to be growth phase dependent , suggesting integration with cellular metabolic state. Understanding how environmental factors influence this system would provide insights into L. plantarum adaptation strategies and potential applications in variable environments like the human gastrointestinal tract.

What are the unexplored interactions between lp_3582 and host factors in the gut environment?

The potential interactions between lp_3582 and host factors in the gut environment present several intriguing research directions:

• Epithelial cell interactions:

  • Co-culture studies with intestinal epithelial cell lines

  • Analysis of epithelial gene expression changes in response to wild-type vs. lamB-deficient strains

  • Investigation of potential direct binding between processed LamD558 peptide and host cell receptors

• Mucosal immune system interactions:

  • Effects on dendritic cell maturation and cytokine production

  • Influence on regulatory T cell development and function

  • Alterations in mucosal antibody production and specificity

• Host-derived molecules affecting lp_3582:

  • Impact of host antimicrobial peptides on lamBDCA expression

  • Effects of host hormones and neurotransmitters on quorum sensing

  • Influence of bile acids and digestive enzymes on peptide processing

• Methodological approaches:

  • Transcriptomics of both bacterial and host cells in co-culture

  • Gnotobiotic animal models with wild-type and mutant strains

  • Intestinal organoid systems for controlled host-microbe interaction studies

Research has already demonstrated that L. plantarum strains can enhance human mucosal and systemic immunity , but the specific contribution of lp_3582 and the lamBDCA system to these effects remains an open question for investigation.

What computational approaches can advance understanding of lp_3582 structure-function relationships?

Advanced computational approaches offer powerful tools for understanding lp_3582 structure-function relationships:

• Structural prediction and analysis:

  • Homology modeling based on known AgrB structures

  • Ab initio modeling of poorly conserved regions

  • Molecular dynamics simulations to predict conformational changes

  • Prediction of transmembrane topology and membrane interaction surfaces

• Functional domain identification:

  • Sequence conservation analysis across bacterial species

  • Identification of coevolving residues suggesting functional coupling

  • Active site prediction based on physicochemical properties

  • Domain motion analysis through normal mode analysis

• Interaction prediction:

  • Molecular docking of precursor peptides and other substrates

  • Protein-protein interaction surface mapping

  • Prediction of allosteric regulatory sites

  • Simulation of membrane environment effects on protein dynamics

• Integration with experimental approaches:

  • Guiding site-directed mutagenesis experiments

  • Interpreting mass spectrometry and structural data

  • Designing optimized protein variants with enhanced function

  • Predicting the impact of environmental conditions on protein stability

These computational approaches, when integrated with experimental validation, can accelerate understanding of how lp_3582 structure determines its peptide processing function and regulatory role in L. plantarum physiology.