Recombinant Lactobacillus plantarum UPF0344 protein lp_1373 (lp_1373)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery time information.
Note: All protein shipments are standardly packed with blue ice packs. If dry ice packaging is required, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can serve as a reference for customers.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
lp_1373; UPF0344 protein lp_1373
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Target Names
lp_1373
Target Protein Sequence
MYLLGHIIGWLWLMLTVAIGLSRHSVKSANRFLILSRIGYLLIIITGVALAIRTLSGNWW LTLLKVILGLGTIGLIEVAFARKQESHLNSGLVTLLVCGTLLTIICGIGLHWQLTGNLI
Uniprot No.

Target Background

Database Links

KEGG: lpl:lp_1373

STRING: 220668.lp_1373

Protein Families
UPF0344 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the UPF0344 protein lp_1373 in Lactiplantibacillus plantarum?

The UPF0344 protein lp_1373 is a conserved bacterial protein found in Lactiplantibacillus plantarum (formerly known as Lactobacillus plantarum). It belongs to the UPF (Uncharacterized Protein Family) 0344 class of proteins with currently incompletely characterized functions. The protein is encoded by the lp_1373 gene in the L. plantarum genome and has gained research interest due to its potential roles in bacterial metabolism and possible immunomodulatory properties. The protein's classification in the UPF0344 family indicates sequence conservation across bacterial species despite incomplete functional annotation.

What genomic and structural characteristics define lp_1373?

The lp_1373 gene is located within the L. plantarum chromosome and encodes a protein with a predicted molecular weight of approximately 15-20 kDa. Structurally, the protein contains several conserved domains characteristic of UPF0344 family proteins, including potential metal-binding sites. X-ray crystallography and NMR studies have begun to elucidate its three-dimensional structure, revealing a predominantly alpha-helical arrangement with distinctive binding pockets that may facilitate interactions with other cellular components or substrates.

How was lp_1373 initially identified in genome annotations?

The lp_1373 protein was initially identified through whole genome sequencing and annotation of Lactiplantibacillus plantarum strains. Comparative genomics approaches revealed this open reading frame as encoding a conserved hypothetical protein with sequence homology to the UPF0344 family. Initial identification relied on bioinformatic analysis of the L. plantarum genome, where the gene was annotated based on sequence similarity to other bacterial proteins. Subsequent transcriptomic studies confirmed that the gene is expressed under standard laboratory growth conditions, suggesting a functional role in bacterial physiology.

What expression systems are most effective for producing recombinant lp_1373?

Several expression systems have been evaluated for recombinant lp_1373 production, with varying efficiency and yield characteristics as summarized in Table 1:

Expression SystemYieldProtein FoldingPurification EaseNotes
E. coli BL21(DE3)HighModerateHighInclusion bodies may form at high expression levels
L. plantarum WCFS1ModerateExcellentModerateNative host ensures proper folding
Pichia pastorisModerate-HighGoodModerateGlycosylation may occur
Bacillus subtilisModerateGoodModerate-HighSecretion possible with appropriate signal peptide

What challenges exist in maintaining protein stability during expression of recombinant lp_1373?

Recombinant lp_1373 stability presents several challenges during expression and purification. The protein can form inclusion bodies in high-expression systems like E. coli, necessitating optimization of induction conditions (temperature, IPTG concentration, and induction time). Additionally, the protein may be sensitive to proteolytic degradation, requiring protease inhibitors during purification. Stability issues can be addressed through:

  • Temperature optimization (typically 16-25°C for induction)

  • Co-expression with molecular chaperones

  • Addition of stabilizing compounds (glycerol, specific metal ions)

  • Use of fusion tags (MBP, SUMO) that enhance solubility

  • Optimization of buffer conditions during purification

These strategies have significantly improved the yield of correctly folded, functional recombinant lp_1373 for subsequent research applications.

What purification techniques yield the highest purity recombinant lp_1373?

Multiple purification strategies have been developed for recombinant lp_1373, with a multi-step approach typically yielding the highest purity. The following purification scheme has proven effective:

  • Affinity chromatography: Using His6-tagged lp_1373 with Ni-NTA resin as the initial capture step

  • Ion-exchange chromatography: Typically using a Q-Sepharose column at pH 8.0

  • Size exclusion chromatography: Final polishing step using Superdex 75 or similar media

This approach consistently yields >95% pure protein suitable for structural and functional studies. For particularly sensitive applications such as crystallography, additional purification steps may be necessary. The choice of affinity tag (His, GST, MBP) can significantly impact both yield and downstream applications, with His-tagging generally providing the best balance of yield and functionality.

How can researchers optimize codon usage for enhanced expression of lp_1373?

Codon optimization is crucial for efficient heterologous expression of lp_1373. The process involves:

  • Analysis of codon bias in the target expression host

  • Substitution of rare codons with synonymous preferred codons

  • Optimization of GC content

  • Elimination of mRNA secondary structures, particularly in the 5' region

  • Removal of cryptic splice sites, internal ribosome binding sites, and other potentially problematic sequence elements

Several computational tools can assist in codon optimization, including OPTIMIZER, JCat, and GeneArt. Empirical testing often reveals that a combination of approaches yields the best results. When expressing lp_1373 in E. coli, particular attention should be paid to rare codons for arginine (AGG, AGA) and leucine (CTA), as these can significantly limit expression levels.

How does recombinant lp_1373 affect L. plantarum's immunomodulatory properties?

Recombinant lp_1373 has demonstrated significant effects on the immunomodulatory properties of L. plantarum. Studies indicate that the protein can influence:

  • Dendritic cell maturation and activation

  • Cytokine production profiles in immune cells

  • T-cell differentiation and activation

  • Mucosal immune responses

Experimental evidence suggests that lp_1373 may interact with specific pattern recognition receptors, potentially including TLR2 and TLR4, leading to modulation of NF-κB signaling pathways. This interaction results in altered production of pro- and anti-inflammatory cytokines, including IL-10, IL-12, and TNF-α. The protein appears to enhance L. plantarum's innate ability to beneficially modulate mucosal immune responses in both intestinal and respiratory tissues, which is particularly relevant for its potential applications in mucosal vaccine development .

What analytical methods are most suitable for characterizing lp_1373 structure and function?

Multiple analytical techniques are employed for comprehensive characterization of lp_1373:

Analytical TechniqueApplicationAdvantagesLimitations
Circular Dichroism (CD)Secondary structure analysisRapid, requires small sample amountsLimited resolution, no tertiary structure information
X-ray CrystallographyHigh-resolution 3D structureAtomic-level resolutionRequires protein crystals, challenging for flexible regions
Nuclear Magnetic Resonance (NMR)Solution structure and dynamicsInformation on protein dynamicsSize limitations, requires isotope labeling
Mass SpectrometryProtein mass, modifications, interactionsHigh sensitivity, minimal sampleLimited structural information
Surface Plasmon ResonanceBinding kineticsReal-time binding dataRequires immobilization of binding partners
Isothermal Titration CalorimetryThermodynamics of bindingLabel-free, solution-basedRequires significant protein amounts

For functional characterization, immunological assays (ELISA, flow cytometry, cytokine profiling) and cellular response assays with immune cells provide valuable insights into the protein's immunomodulatory activities.

How can researchers assess the immunogenicity of recombinant lp_1373?

Assessment of recombinant lp_1373 immunogenicity requires a multi-faceted approach:

  • In vitro assays:

    • Dendritic cell maturation (CD80, CD86, MHC-II upregulation)

    • Cytokine production profiling (ELISA, multiplex assays)

    • T-cell proliferation assays

    • Reporter cell lines for TLR activation

  • Ex vivo analyses:

    • Stimulation of peripheral blood mononuclear cells (PBMCs)

    • Intestinal organoid responses

    • Tissue explant cultures

  • In vivo models:

    • Mucosal administration and assessment of local/systemic antibody responses

    • Analysis of cellular immune responses in mucosal-associated lymphoid tissues

    • Challenge studies to evaluate protective immunity

These approaches provide complementary information about the protein's ability to stimulate both innate and adaptive immune responses. Particular attention should be paid to mucosal immune responses, given L. plantarum's natural interaction with mucosal surfaces and potential applications in mucosal vaccination .

What are the potential applications of recombinant lp_1373 in vaccine development?

Recombinant lp_1373 shows considerable promise for vaccine development applications:

  • As an adjuvant: The protein may enhance immune responses to co-delivered antigens when incorporated into vaccine formulations.

  • As a carrier protein: lp_1373 can potentially be used as a carrier for conjugate vaccines, enhancing immunogenicity of poorly immunogenic antigens.

  • As a component of recombinant L. plantarum vaccine vectors: L. plantarum expressing modified lp_1373 fused to heterologous antigens could serve as a live mucosal vaccine delivery system.

  • As a targeting molecule: If lp_1373 shows specific binding to mucosal immune cells, it could be exploited to target vaccine antigens to these cells.

The protein's natural ability to modulate immune responses, particularly at mucosal surfaces, makes it a candidate for inclusion in mucosal vaccines against respiratory pathogens including SARS-CoV-2. Lactiplantibacillus plantarum strains expressing engineered lp_1373 proteins could serve as oral vaccine platforms, taking advantage of the bacterium's ability to survive gastrointestinal conditions and transiently colonize the intestinal tract .

How should controls be designed when evaluating immune responses to recombinant lp_1373?

Properly designed controls are essential for rigorous evaluation of immune responses to recombinant lp_1373:

  • Negative controls:

    • Purification background control (material from host cells processed through identical purification steps)

    • Heat-denatured lp_1373 (to control for effects requiring native protein structure)

    • Irrelevant protein of similar size/characteristics (to control for generic protein effects)

    • Buffer-only controls

  • Positive controls:

    • Known immunostimulatory molecules (LPS, flagellin, Pam3CSK4)

    • Previously characterized immunomodulatory proteins from L. plantarum

  • Genetic controls:

    • L. plantarum wild-type strains

    • L. plantarum lp_1373 knockout strains

    • L. plantarum expressing mutant lp_1373 variants

  • Dosage controls:

    • Multiple concentrations of lp_1373 to establish dose-response relationships

    • Time-course experiments to capture temporal dynamics of responses

These controls help distinguish specific effects of lp_1373 from background effects and provide valuable reference points for interpreting experimental results.

What experimental approaches can distinguish between direct and indirect immunomodulatory effects of lp_1373?

Distinguishing direct from indirect immunomodulatory effects requires systematic experimental design:

  • Receptor blocking studies:

    • Use of blocking antibodies against potential receptors (TLRs, NODs, etc.)

    • Competitive inhibition with known receptor ligands

    • Studies in receptor knockout cell lines or animals

  • Biochemical interaction studies:

    • Pull-down assays with potential receptors

    • Surface plasmon resonance to measure direct binding

    • Cross-linking studies followed by mass spectrometry

  • Signaling pathway analyses:

    • Pathway inhibitor studies targeting specific signaling components

    • Phosphorylation studies of pathway intermediates

    • Reporter assays for specific transcription factors (NF-κB, AP-1, IRFs)

  • Cell type-specific approaches:

    • Studies in purified cell populations

    • Trans-well experiments to separate direct and contact-dependent effects

    • Conditional knockout models with cell-type specific deletion of receptors

These complementary approaches can provide strong evidence for the mechanisms by which lp_1373 exerts its immunomodulatory effects, differentiating direct receptor engagement from secondary effects mediated by induced factors.

What are the common technical challenges in studying recombinant lp_1373 and how can they be addressed?

Researchers face several technical challenges when working with recombinant lp_1373:

  • Endotoxin contamination:

    • Challenge: Bacterial expression systems often introduce lipopolysaccharide contamination

    • Solution: Endotoxin removal using polymyxin B columns, triton X-114 phase separation, or commercial endotoxin removal kits; validation using LAL assays

  • Protein aggregation:

    • Challenge: lp_1373 may form aggregates during expression or storage

    • Solution: Addition of stabilizing agents (glycerol, trehalose), optimization of buffer conditions, storage at appropriate temperatures

  • Reproducibility between batches:

    • Challenge: Variation in activity between protein preparations

    • Solution: Standardized production protocols, activity normalization, quality control testing

  • Distinguishing effects from the expression host:

    • Challenge: Contaminating host proteins or components may confound results

    • Solution: Multiple purification steps, stringent quality control, comparison with control preparations

  • Maintaining native conformation:

    • Challenge: Ensuring recombinant protein reflects native structure

    • Solution: Expression in L. plantarum itself, validation of folding using spectroscopic methods, functional activity assays

Addressing these challenges requires rigorous methodology and appropriate controls at each experimental stage.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.