Recombinant Lactobacillus plantarum UPF0397 protein lp_0150 (lp_0150)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant Lp_0150 is produced under optimized conditions in E. coli and purified using immobilized metal affinity chromatography (IMAC) due to the His tag .

ParameterSpecification
Expression SystemEscherichia coli
TagN-terminal His tag
Purity>90% (SDS-PAGE)
FormLyophilized powder or liquid (Tris/PBS buffer with 6% trehalose, pH 8.0)
Storage-20°C/-80°C (long-term); 4°C (short-term working aliquots)
ReconstitutionSterile deionized water (0.1–1.0 mg/mL) with optional 50% glycerol

Stability and Functional Properties

Recombinant Lp_0150 exhibits robust stability under harsh conditions:

  • Thermal Stability: Retains structural integrity at 50°C .

  • pH Tolerance: Stable at pH 1.5 .

  • Proteolytic Resistance: Resists degradation in high-salt environments .

These properties make it suitable for gastrointestinal tract studies or oral vaccine delivery systems .

Protein Interaction Studies

Lp_0150’s interactome remains uncharacterized, but yeast two-hybrid and co-IP assays could elucidate its role in bacterial signaling or host-pathogen interactions .

Comparative Analysis with Related Recombinant Proteins

ProteinHostTagApplicationReference
Lp_0150E. coliHisStructural studies, antigen display
SARS-CoV-2 SpikeL. plantarumNoneOral vaccine development
FomA (Fusobacterium)L. plantarumpgsA'IBD treatment via immune modulation

Challenges and Future Directions

  • Functional Annotation: The biological role of Lp_0150 in L. plantarum is unknown .

  • Immunogenicity Testing: Requires in vivo studies to evaluate its efficacy as a vaccine adjuvant.

  • Commercial Availability: Sold by vendors like Creative BioMart and MyBioSource for research use .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C; lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is finalized during production. To request a specific tag, please indicate this in your order; we will prioritize fulfilling your request.
Synonyms
lp_0150; UPF0397 protein lp_0150
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-186
Protein Length
full length protein
Species
Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Target Names
lp_0150
Target Protein Sequence
MQNKQSNSIRTVVATGIGAAVIFVLMKFVAIPTGVPNTQVNVAMGFLALLGAIFGPVAAG LAVFIGHALNDFVTYGSPWWTWVIVDGLIGVAFGLAKNRLKIENGVLGTAKLVWFNIYQI IVNFIGWVLLAPTGDIIIYHEPANKVYLQGVITWIADSISVAIIGTILLVLYARTRTQRG SLTKER
Uniprot No.

Target Background

Database Links

KEGG: lpl:lp_0150

STRING: 220668.lp_0150

Protein Families
UPF0397 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage and handling conditions for this recombinant protein?

For optimal stability and activity retention, the recombinant lp_0150 protein should be stored at -20°C to -80°C immediately upon receipt . To minimize protein degradation from repeated freeze-thaw cycles, it is recommended to aliquot the reconstituted protein into working volumes appropriate for single-use experiments .

When reconstituting the lyophilized protein, first centrifuge the vial briefly to collect the powder at the bottom, then add deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL . For long-term storage, add glycerol to a final concentration of 5-50% (with 50% being the standard recommendation) before aliquoting and storing at -20°C/-80°C . Working aliquots may be stored at 4°C for up to one week without significant loss of activity .

How can I verify the expression and purification of lp_0150 in my experiments?

To verify successful expression and purification of recombinant lp_0150 protein:

SDS-PAGE Analysis: Run samples on 12-15% gels to confirm the expected molecular weight (approximately 20-22 kDa including the His-tag) . A single prominent band should be visible with >90% purity.

Western Blotting: Perform immunoblotting using:

  • Anti-His antibodies to detect the N-terminal His-tag

  • Specific antibodies against lp_0150 if available

Flow Cytometry: This can be used to verify surface expression if the protein is being displayed on cell surfaces, similar to methods used for other L. plantarum surface proteins .

Mass Spectrometry: For definitive identification and to confirm the intact mass or peptide fingerprint of the purified protein.

Protein Quantification: Use standard methods such as Bradford assay or BCA assay, adjusting for potential interference from buffer components.

How can I design experiments to study the function of lp_0150 in stress response?

A comprehensive experimental design to study lp_0150's role in stress response should include:

1. Gene Expression Analysis Under Stress Conditions:

  • Compare lp_0150 expression levels across various stress conditions (acid, bile, oxidative, osmotic stress)

  • Use qRT-PCR and/or RNA-seq to quantify expression changes

  • Create a time-course profile to track expression dynamics

2. Gene Deletion and Complementation:

  • Generate Δlp_0150 knockout strains using CRISPR-Cas9 or traditional homologous recombination

  • Create complementation strains to confirm phenotype specificity

  • Compare growth curves and survival rates between wild-type, knockout, and complemented strains

3. Phenotypic Characterization:

  • Assess growth parameters in standard and stress conditions

  • Measure survival rates in simulated gastric juice (pH 2.3-2.4) and intestinal conditions

  • Evaluate membrane integrity using fluorescent dyes

4. Protein Interaction Studies:

  • Conduct pull-down assays to identify binding partners

  • Perform bacterial two-hybrid screening

  • Use cross-linking approaches to capture transient interactions

Experimental Design Table:

Experimental ConditionWild-typeΔlp_0150Complemented
Standard Growth (MRS)Growth rate, CFU/mLGrowth rate, CFU/mLGrowth rate, CFU/mL
Acid Stress (pH 2.3-4.0)Survival rate, gene expressionSurvival rateSurvival rate
Bile Stress (10-50 mM)Survival rate, gene expressionSurvival rateSurvival rate
Oxidative Stress (H₂O₂ 1-5 mM)Survival rate, gene expressionSurvival rateSurvival rate
Osmotic Stress (NaCl 2-10%)Survival rate, gene expressionSurvival rateSurvival rate

Include appropriate controls and statistical analysis methods (ANOVA with post-hoc tests) to ensure robust data interpretation .

What are the considerations for expressing lp_0150 as a surface-displayed protein in L. plantarum?

Surface display of lp_0150 in L. plantarum requires careful consideration of several factors:

1. Selection of Appropriate Surface Anchoring Domain:
The pgsA anchoring motif has been successfully used for surface display of proteins in L. plantarum, as demonstrated with the gp85 protein . This system allows proper folding and presentation of the target protein on the bacterial surface. Alternative anchoring domains include LysM domains or LPXTG-anchoring motifs which interact with peptidoglycan layers.

2. Expression Vector Design:
Create a shuttle vector similar to pMG36e:pgsA:target , where pgsA functions as the surface display motif. The construct should include:

  • Strong constitutive or inducible promoter

  • Signal sequence for secretion

  • Surface anchoring domain (pgsA)

  • Target gene (lp_0150)

  • Appropriate selection markers

3. Verification Methods:

  • Western blotting of cell wall fractions

  • Flow cytometry analysis of whole cells using specific antibodies

  • Immunofluorescence microscopy

  • Functional assays to confirm properly folded protein

4. Expression Optimization:

  • Optimize codon usage for L. plantarum

  • Test different signal sequences for secretion efficiency

  • Evaluate promoter strength under various conditions

  • Adjust growth conditions (temperature, pH, media composition)

5. Potential Challenges:

  • Protein misfolding or aggregation

  • Low surface expression levels

  • Impact on bacterial growth and fitness

  • Proteolytic degradation of the fusion protein

This surface display approach has been successfully applied for developing oral vaccines using L. plantarum , suggesting it could be adapted for studying lp_0150 function in different contexts.

How can I investigate interactions between lp_0150 and the host gastrointestinal environment?

To investigate interactions between lp_0150 and the host gastrointestinal environment, a multi-faceted approach is recommended:

1. In Vitro Models:

  • Cell Culture Interactions: Assess adhesion and interactions with intestinal epithelial cell lines (Caco-2, HT-29)

  • Co-culture Systems: Evaluate interactions in more complex models incorporating immune cells

  • Transwell Systems: Study translocation and barrier function effects

2. Ex Vivo Approaches:

  • Intestinal Organoids: Utilize 3D intestinal organoids to model complex epithelial interactions

  • Intestinal Tissue Explants: Examine interactions with intact tissue architecture

3. In Vivo Studies:

  • Animal Models: Investigate colonization, persistence, and host responses in mice or other animal models

  • Gnotobiotic Models: Use germ-free or defined microbiota models to eliminate confounding microbial influences

4. Molecular Interaction Analysis:

  • Pull-down Assays: Identify host proteins that interact with lp_0150

  • Surface Plasmon Resonance: Measure binding kinetics to potential host receptors

  • Transcriptomics: Assess host gene expression changes upon exposure to wild-type vs. Δlp_0150 L. plantarum

5. Functional Readouts:

  • Immune Response: Measure cytokine production, immune cell activation

  • Barrier Function: Assess epithelial tight junction integrity, permeability

  • Microbial Community Impact: Analyze effects on resident microbiota composition

When designing these experiments, it's important to control for strain-specific effects by comparing multiple L. plantarum strains, as different isolates can exhibit varied bio-functional properties . Additionally, methodological considerations such as appropriate controls, statistical power, and physiologically relevant conditions are essential for generating meaningful data .

What role might lp_0150 play in the immunomodulatory effects of L. plantarum?

While specific immunomodulatory functions of lp_0150 have not been directly characterized in the available literature, its potential role can be investigated based on approaches used with other L. plantarum proteins.

L. plantarum has demonstrated immunomodulatory capabilities, as evidenced by studies using recombinant L. plantarum expressing gp85 protein as an oral vaccine in chickens . This approach elicited protective immune responses with high levels of serum IgG and secretory IgA in bile and duodenal-mucosal fluid .

To investigate potential immunomodulatory effects of lp_0150:

1. Comparative Immunological Analysis:

  • Compare immune responses to wild-type L. plantarum versus Δlp_0150 knockout strains

  • Measure cytokine profiles (IL-10, IL-12, TNF-α, IFN-γ)

  • Assess dendritic cell maturation and T-cell polarization

2. Recombinant Expression Approaches:

  • Express lp_0150 on the bacterial surface using pgsA or other anchoring domains

  • Evaluate immune responses in vitro and in vivo

  • Measure antibody titers (IgG, IgA) and T-cell responses

3. Mechanistic Studies:

  • Identify potential pattern recognition receptors (TLRs, NODs) that might interact with lp_0150

  • Investigate signaling pathways activated by lp_0150 exposure

  • Examine effects on antigen-presenting cell function

Immunological Readout Comparison Table:

Immune ParameterWild-type L. plantarumΔlp_0150 L. plantarumPurified lp_0150 protein
Dendritic Cell MaturationCD80/CD86/MHC-II levelsCD80/CD86/MHC-II levelsCD80/CD86/MHC-II levels
Cytokine ProductionIL-10, IL-12, TNF-α, IFN-γIL-10, IL-12, TNF-α, IFN-γIL-10, IL-12, TNF-α, IFN-γ
T-cell PolarizationTh1/Th2/Th17/Treg ratiosTh1/Th2/Th17/Treg ratiosTh1/Th2/Th17/Treg ratios
Antibody Response (in vivo)Serum IgG, Mucosal IgASerum IgG, Mucosal IgASerum IgG, Mucosal IgA

The significant difference in antibody responses observed with other L. plantarum-expressed recombinant proteins suggests that surface-expressed bacterial proteins can effectively stimulate both systemic and mucosal immunity , providing a methodological framework for testing lp_0150's potential immunomodulatory properties.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.