Recombinant Lactobacillus reuteri Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Description

Introduction to Lactobacillus reuteri

Lactobacillus reuteri is a probiotic bacterium known for its health benefits, including immunomodulation and the prevention of various diseases. It has been engineered to produce therapeutic proteins, such as interleukin-22 (IL-22), which can help in treating conditions like nonalcoholic fatty liver disease . L. reuteri is widely studied for its potential in delivering therapeutic molecules due to its ability to thrive in the gut ecosystem and its genetic stability .

Research Findings and Data

Since there is no specific data available on "Recombinant Lactobacillus reuteri Large-conductance mechanosensitive channel (mscL)", we can only speculate on potential applications based on existing knowledge:

  • Therapeutic Applications of L. reuteri: Engineered L. reuteri strains have shown promise in treating various conditions by secreting therapeutic proteins .

  • MscL as a Target: In other bacteria, MscL has been identified as a potential target for antibiotics due to its role in osmotic stress response .

Example Table: Therapeutic Applications of Engineered L. reuteri

Therapeutic ProteinCondition TreatedKey Findings
Interleukin-22 (IL-22)Nonalcoholic Fatty Liver DiseaseReduced liver weight and triglycerides in mice
Murine IFN-βRadiation ToxicityMitigated radiation toxicity in mice

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mscL; Lreu_0317; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-123
Protein Length
full length protein
Species
Lactobacillus reuteri (strain DSM 20016)
Target Names
mscL
Target Protein Sequence
MLKEFKTFIARGNVIDMAVGIIVGAAFTSIVKSLVNNLINPLIGLFIGRIDLSNLVLTVG DAQFKYGSFLNAVINFLIISFVVFLMVKAINTFRKKEDKKTEAPSEEVMYLKEITELLKK NKE
Uniprot No.

Target Background

Function
A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a role in regulating intracellular osmotic pressure changes.
Database Links
Protein Families
MscL family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Lactobacillus reuteri and why is it suitable for recombinant protein expression?

Lactobacillus reuteri (now classified as Limosilactobacillus reuteri) is a gut symbiont species that has evolved to thrive in the gastrointestinal tract of various vertebrates, including humans. This bacterium is particularly valuable for recombinant protein expression for several reasons:

  • It possesses the ability to survive gastrointestinal transit, making it an excellent candidate for therapeutic delivery vehicles

  • Available genetic tools and well-established transformation protocols enable efficient genetic manipulation

  • L. reuteri has multiple probiotic (health-promoting) characteristics

  • It can be engineered to express and deliver therapeutic molecules through secretion or controlled lysis approaches

  • Certain strains like VPL1014 have been successfully used as a chassis for secreting therapeutic molecules

The bacterium's natural adaptation to the gut environment and its safety profile as a probiotic make it particularly suitable for recombinant expressions intended for in vivo applications.

What is the large-conductance mechanosensitive channel (mscL) and what is its significance in bacterial physiology?

The large-conductance mechanosensitive channel (mscL) is a membrane protein that forms a pressure-sensitive channel in bacterial cell membranes. While the search results don't specifically discuss mscL in L. reuteri, understanding this protein is essential for recombinant expression work:

  • MscL functions as a safety valve that opens in response to sudden increases in membrane tension

  • It protects bacteria from osmotic shock by allowing rapid efflux of cytoplasmic solutes

  • The channel has a large conductance, allowing passage of molecules up to 30 Å in diameter

  • In research contexts, mscL can potentially be engineered as a controlled gateway for release of heterologous proteins or therapeutic compounds

The expression of recombinant mscL in L. reuteri could potentially be used to create strains with controlled release capabilities, similar to the lysis-based approach mentioned in the literature .

How do I choose the appropriate L. reuteri strain for recombinant mscL expression?

Selecting the optimal L. reuteri strain for recombinant mscL expression requires consideration of several factors:

  • Human-derived L. reuteri strains (such as ATCC PTA 6475) are often preferred due to available genetic tools and established probiotic characteristics

  • Consider the strain's growth characteristics, as recombinant plasmids may affect growth rates differently across strains

  • Evaluate the strain's natural colonization properties - for example, R2LC and 6475 strains show different niche specificities in the GI tract

  • Assess the strain's adhesion properties, which are mediated by various surface proteins including mucus-binding proteins (MUBs) and other adhesins

  • Consider whether reduced colonization is desirable for your application (as demonstrated in engineered strains with inactivated adhesin genes)

For example, research has shown that L. reuteri ATCC PTA 6475 and R2LC strains have different growth rates when transformed with recombinant plasmids, with 6475 strains generally exhibiting higher growth rates than R2LC strains .

What are the most effective genetic tools and vectors for expressing recombinant mscL in L. reuteri?

Several genetic systems have been successfully employed for recombinant protein expression in L. reuteri:

  • The pSIP expression system has been effectively used for controlled expression of various proteins in L. reuteri, utilizing the inducible promoter PsppQ

  • CRISPR-Cas9-assisted recombineering has been demonstrated to increase efficiency of genetic modifications

  • For stable expression, chromosomal integration may be preferable to plasmid-based systems, as plasmid loss can occur rapidly (within 4 days/~100 generations) in non-selective conditions

  • The SecA2-SecY2 secretion system has been identified as important for surface protein expression in L. reuteri

For example, researchers have successfully created recombinant L. reuteri strains expressing reporter genes by inserting codon-optimized gene cassettes into the pSIP411 vector under control of the inducible promoter PsppQ and transforming these constructs into L. reuteri strains via electroporation .

How can I optimize codon usage for effective mscL expression in L. reuteri?

Codon optimization is critical for efficient expression of heterologous proteins in L. reuteri:

  • Analysis of successful recombinant protein expression in L. reuteri demonstrates the importance of codon optimization, as seen with reporter genes like click beetle red luciferase (CBRluc) and mCherry

  • Design the mscL gene sequence taking into account the codon bias of L. reuteri to enhance translation efficiency

  • Consider using specialized software or services that analyze the target organism's codon usage patterns

  • Optimize the 5' region of the gene to avoid strong secondary structures that might impede translation initiation

  • Include appropriate regulatory elements (ribosome binding sites, promoters) optimized for expression in L. reuteri

Research has shown that codon-optimized genes encoding CBRluc and mCherry were successfully designed, inserted into expression vectors, and transformed into different strains of L. reuteri, resulting in functional expression of these reporter proteins .

What strategies can be employed to improve plasmid stability for recombinant mscL expression in L. reuteri?

Plasmid stability is a significant challenge in L. reuteri engineering, requiring specific strategies to ensure consistent expression:

  • Evaluate plasmid persistence using both flow cytometry (FCM) and conventional plate count (PC) methods, as FCM has been shown to detect lower plasmid loss rates compared to PC in some cases

  • Consider chromosomal integration for long-term stable expression, as plasmid loss can be substantial (100% within 4 days in non-selective cultures)

  • Optimize induction conditions, as protein expression can further decrease growth rate and potentially increase plasmid loss

  • Utilize selective markers appropriate for L. reuteri, such as erythromycin resistance

  • Consider advanced approaches like toxin-antitoxin systems that can enhance plasmid retention even in the absence of selective pressure

Research has shown that recombinant plasmids in L. reuteri (such as pSIP-CBRluc-mCherry, pSIP-CBRluc, and pSIP-mCherry) are not entirely stable in non-selective cultures, with dramatic decreases in plasmid-bearing bacteria after 10 days of subculturing (approximately 100 generations) .

What are the optimal conditions for inducing and detecting recombinant mscL expression in L. reuteri?

Optimal expression conditions must be carefully determined:

  • For inducible systems like the pSIP system, use appropriate induction agents (e.g., SppIP peptide at 50 ng/ml) as demonstrated in previous studies

  • Monitor growth dynamics after induction, as expression of recombinant proteins can impact growth rates

  • Neutralization of pH and longer induction duration can significantly improve protein expression signals, as shown with mCherry expression

  • For detecting expression, Western blotting with antibodies against protein tags or the mscL protein itself would be appropriate

  • Consider using fusion tags that facilitate detection and purification, while ensuring they don't interfere with mscL function

Research has demonstrated that induction of reporter gene expression in recombinant L. reuteri strains decreased their growth rate compared to wild-type strains, highlighting the importance of optimizing induction conditions to balance expression levels with bacterial viability .

How can I verify the functionality of recombinant mscL channels in L. reuteri membranes?

Verifying mscL functionality requires specialized techniques:

  • Patch-clamp electrophysiology remains the gold standard for directly measuring mscL channel activity

  • Hypoosmotic shock survival assays can indirectly assess mscL function by comparing survival rates between wild-type and recombinant strains

  • Fluorescent dye release assays using calcein or other fluorescent molecules can demonstrate channel opening in response to osmotic pressure changes

  • For in vivo tracking of bacteria expressing mscL, consider using dual-reporter systems similar to the CBRluc-mCherry system that has been successfully employed in L. reuteri

  • Electron microscopy can be used to visualize structural integration of mscL in the bacterial membrane

When designing these functional assays, it's important to include appropriate controls, such as strains expressing non-functional mscL mutants or wild-type strains without recombinant mscL.

What techniques can be used to study the localization and membrane integration of recombinant mscL in L. reuteri?

Several approaches can be employed to investigate mscL localization:

  • Fluorescent fusion proteins (such as mCherry-mscL fusions) can allow visualization of mscL localization in live cells, similar to fluorescent reporter systems previously used in L. reuteri

  • Fractionation methods to separate membrane fractions followed by Western blotting can confirm membrane integration

  • Protease accessibility assays can determine the orientation of mscL in the membrane

  • Immunogold electron microscopy using antibodies against mscL or associated tags can provide high-resolution localization data

  • For comparative studies across different L. reuteri strains, biophotonic imaging techniques have been shown to be effective for tracking bacteria in vivo and in vitro

Previous research has established methods for tracking L. reuteri using reporter proteins that enable both in vivo and in vitro detection, providing useful tools for studying protein localization and bacterial-host interactions .

How can recombinant L. reuteri expressing mscL be engineered for controlled therapeutic delivery?

Engineering L. reuteri for controlled therapeutic delivery via mscL channels requires sophisticated design:

  • Design a system where therapeutic molecules can be released through mscL channels in response to specific triggers (e.g., osmotic pressure changes or other stimuli)

  • Consider a dual-recombineering scheme similar to that used for efficient barcoding of L. reuteri strains

  • Modify mscL to alter its gating properties, potentially creating channels that open in response to specific environmental conditions found in target tissues

  • For applications requiring reduced bacterial persistence, consider engineering L. reuteri strains with inactivated adhesin genes, as demonstrated with the nonuple mutant that had reduced capacity to adhere to enteroid monolayers while maintaining therapeutic efficacy

  • Evaluate gastrointestinal transit survival of the engineered strain, as this is critical for delivery to target sites

Research has shown that L. reuteri can be engineered as a therapeutic delivery vehicle using approaches such as secretion or lysis-based delivery systems, suggesting that mscL-based delivery could be a viable alternative strategy .

How does the host immune system respond to recombinant L. reuteri expressing foreign membrane proteins like mscL?

Understanding immune responses to recombinant L. reuteri expressing membrane proteins is crucial:

  • Characterize innate immune responses using in vitro co-culture systems with immune cells and recombinant L. reuteri

  • Evaluate adaptive immune responses by measuring antibody production against both L. reuteri and the recombinant mscL

  • Consider the potential adjuvant effect of L. reuteri on immune responses to the expressed mscL protein

  • Assess whether engineering L. reuteri with reduced colonization potential (e.g., through inactivation of adhesin genes) affects immune responses

  • Compare the immunogenicity of surface-expressed versus intracellular recombinant proteins

For example, research has demonstrated that a nonuple mutant L. reuteri strain producing murine IFN-β was equally effective as its wild-type counterpart in mitigating radiation toxicity in mice, suggesting that reduced adhesion capacity did not impair therapeutic efficacy .

How can I develop a L. reuteri strain with reduced colonization potential while maintaining effective mscL expression?

Balancing reduced colonization with effective protein expression requires targeted genetic modifications:

  • Target adhesin genes for inactivation, as demonstrated in the development of a nonuple mutant with all nine genes encoding adhesins inactivated

  • Apply CRISPR-Cas9-assisted recombineering for efficient gene inactivation, as shown with the targeting of genes like cnBp

  • Test individual adhesin mutants to identify key proteins for specific adhesion contexts - for example, CmbA has been identified as a key protein in L. reuteri adhesion to HT-29 and enteroid cells

  • Evaluate gastrointestinal transit survival of mutant strains, as this should be maintained despite reduced adhesion capacity

  • Consider using dual-reporter systems for tracking both bacterial localization and protein expression, similar to the CBRluc-mCherry system previously used in L. reuteri

Research has shown that L. reuteri strains with multiple inactivated adhesin genes maintained their ability to survive gastrointestinal transit in mice while showing reduced capacity to adhere to enteroid monolayers, providing a promising approach for developing therapeutic delivery platforms with reduced colonization potential .

What are common challenges in expressing membrane proteins like mscL in L. reuteri and how can they be addressed?

Expressing membrane proteins presents unique challenges that require specific strategies:

  • Membrane protein overexpression can be toxic; use tightly regulated induction systems like the PsppQ promoter to control expression levels

  • Consider the impact of induction on growth rate, as recombinant strains with induced protein expression show decreased growth compared to wild-type strains

  • Optimize signal sequences for proper targeting to the membrane, potentially utilizing native L. reuteri signal peptides

  • For surface display of mscL or mscL domains, consider leveraging natural adhesins or surface proteins of L. reuteri as fusion partners

  • If protein misfolding occurs, explore co-expression with appropriate chaperones or adjusting growth temperatures during expression

When evaluating expression systems, consider that previous research has shown that some constructs (e.g., those under constitutive promoters like P11) may not yield stable and functional clones in L. reuteri, necessitating careful selection of expression systems .

How can I address plasmid instability issues when expressing recombinant mscL in L. reuteri?

Plasmid instability requires specific mitigation strategies:

Research has shown that recombinant plasmids in L. reuteri are not entirely stable in non-selective cultures, with the number of plasmid-bearing bacteria dramatically decreasing after being subcultured for 10 days (approximately 100 generations) .

What controls should be included in experiments involving recombinant L. reuteri expressing mscL?

Comprehensive experimental controls are essential for rigorous research:

Control TypePurposeImplementation
Wildtype L. reuteriBaseline comparisonUse the parent strain without genetic modifications
Empty vector controlControl for effects of the vectorTransform L. reuteri with expression vector lacking mscL
Inactive mscL mutantControl for protein expressionExpress a non-functional mscL variant
Growth rate comparisonAssess metabolic burdenCompare growth curves with/without induction
Plasmid stability analysisMonitor expression consistencyTrack plasmid retention over time using both FCM and PC methods
Strain-specific controlsAccount for strain variationInclude multiple L. reuteri strains (e.g., 6475 and R2LC)
In vivo controlsValidate biological relevanceUse different bacterial doses and timepoints for in vivo studies

Previous research has employed such controls when working with recombinant L. reuteri, comparing growth characteristics of recombinant strains (e.g., 6475-CBRluc-mCherry, 6475-mCherry, R2LC-mCherry and R2LC-CBRluc) with wild-type 6475 and R2LC strains in the presence and absence of inducing agents .

How should dose-response relationships be analyzed when studying recombinant mscL function in L. reuteri?

Rigorous analysis of dose-response relationships requires systematic approaches:

  • Design experiments with multiple, precisely defined doses of inducer (e.g., SppIP at various concentrations) to correlate induction levels with mscL expression and function

  • For in vivo applications, test a range of bacterial doses (e.g., from 1×10^5 to 1×10^10 CFU) to determine minimum effective doses, as has been done with reporter-expressing L. reuteri strains

  • Use appropriate statistical methods for dose-response curve fitting, such as four-parameter logistic regression

  • Include time as a variable in analyses, as protein expression and bacterial localization can change significantly over time

  • Consider strain-specific differences in dose responses, as different L. reuteri strains (e.g., 6475 vs. R2LC) may show different behaviors even with identical constructs

Previous research with biophotonic imaging of L. reuteri has demonstrated dose-dependent signal intensity in the gastrointestinal tract of mice, with detectable luminescence signals at doses ranging from 1×10^5 to 1×10^10 CFU .

What techniques are most effective for tracking recombinant L. reuteri expressing mscL in complex environments?

Tracking recombinant bacteria requires sophisticated imaging and detection methods:

  • Biophotonic imaging (BPI) using reporter genes like CBRluc and mCherry has been shown to be suitable for tracking L. reuteri both in vivo and in vitro

  • In vivo imaging systems (IVIS) can detect fluorescence from bacteria expressing reporters at doses of 1×10^10 CFU and luminescence signals at doses ranging from 1×10^5 to 1×10^10 CFU

  • Flow cytometry provides a sensitive method for quantifying bacteria expressing fluorescent proteins and assessing plasmid stability

  • For studying interactions with host cells, fluorescent microscopy of tagged bacteria can reveal adhesion patterns, as demonstrated with mCherry-producing R2LC adhering to intercellular junctions of cultured IPEC-J2 cells

  • Consider strain-specific localization patterns - for example, R2LC-CBRluc was found predominantly in the stomach while 6475-CBRluc-mCherry localized to the colon 1-2 hours after ingestion

The choice of tracking method should be determined by the specific research question, with consideration for the sensitivity required and the environment being studied.

How can contradictory experimental results in mscL functionality studies be reconciled and analyzed?

Addressing contradictory results requires systematic investigation:

When faced with contradictory results, it is essential to systematically investigate each variable that could impact experimental outcomes, drawing on established protocols for working with recombinant L. reuteri while adapting them to the specific challenges of membrane protein expression.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.