Recombinant Lactobacillus sakei subsp. sakei Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Description

Introduction to Lactobacillus sakei subsp. sakei Large-Conductance Mechanosensitive Channel (MscL)

The Large-conductance Mechanosensitive Channel (MscL) from Lactobacillus sakei subsp. sakei is a protein that functions as a mechanosensitive ion channel . Mechanosensitive channels respond to mechanical stimuli, such as pressure or membrane stretch, by opening a pore that allows ions to flow across the cell membrane . MscL is found in bacteria and plays a role in protecting cells from osmotic shock .

Discovery and Isolation of Lactobacillus sakei MscL

Lactobacillus sakei is a lactic acid bacterium (LAB) traditionally isolated from fermented foods . Researchers isolated L. sakei HEM 224 from Korean kimchi and identified it through 16S rRNA sequencing, which showed high similarity to L. sakei . Another strain, L. sakei WIKIM30, was isolated from homemade kimchi and identified based on 16S rRNA gene sequence analysis .

Functional Properties and Applications of Recombinant MscL

MscL's function in Escherichia coli was examined by expressing it on a plasmid as a fusion protein with glutathione S-transferase in an E. coli strain with a chromosomal mscL gene disruption . The purified protein was reconstituted into artificial liposomes and found to be fully functional when examined with the patch-clamp technique . The reconstituted recombinant MscL protein formed ion channels exhibiting characteristic conductance and pressure sensitivity and was blocked by the mechanosensitive ion channel inhibitor gadolinium .

  • Probiotic Applications Lactobacillus sakei strains have probiotic potential in various mucosal regions . For example, L. sakei CVL-001 can enhance mesenchymal stem cell (MSC) therapy for ulcerative colitis by increasing the secretion of interleukin-10 (IL-10), a cytokine crucial for reducing inflammation and maintaining immune homeostasis . In a DSS-induced colitis mouse model, administration of these primed MSCs led to improved recovery, reduced inflammation, and better survival outcomes compared to unmodified MSCs .

  • Delivery of Therapeutic Agents Recombinant Lactobacillus can deliver therapeutic agents, especially proteins, to the gastrointestinal (GI) tract . A system for expressing exogenous proteins at a high level was developed using a combination of an L-lactate dehydrogenase (ldhL) promoter of Lactobacillus sakei with a backbone from pLEM415, which yielded the highest level of reporter expression .

  • Biofilm Inhibition The crude extract of the bacteriocin of Lactobacillus sakei 1 inhibits biofilm formation by Listeria monocytogenes, with greater antagonism in the presence of inulin . This suggests that combined use of probiotics and prebiotics can increase the anti-biofilm effect .

  • Treatment of Atopic Dermatitis Oral administration of L. sakei WIKIM30 modulates allergic Th2 responses, enhancing Treg generation and increasing the relative abundance of intestinal bacteria that are positively related to Treg generation, suggesting therapeutic potential for treating atopic dermatitis (AD) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a useful reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
mscL; LCA_1638; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-132
Protein Length
full length protein
Species
Lactobacillus sakei subsp. sakei (strain 23K)
Target Names
mscL
Target Protein Sequence
MIKEFKEFIMRGNVLDMAVGVILGAALKSIVDSLTKNLINPIISLFVGQVDLSGIAVTIP GTKAVFQIGNFLNDVINFLIIAIIVFLIVKGFNKLRDMGKKTEEEVAEEAAPTQEELYLK EIRDLLANKDHQ
Uniprot No.

Target Background

Function
A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a role in regulating cellular osmotic pressure changes.
Database Links
Protein Families
MscL family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure and function of the MscL channel in Lactobacillus sakei?

The large-conductance mechanosensitive channel (MscL) in L. sakei functions as a pressure relief valve during osmotic downshift, similar to its homolog in L. lactis. Based on comparative analysis with other lactic acid bacteria, MscL in L. sakei likely forms a pentameric structure that creates a large pore when activated by membrane tension. When the turgor pressure of the cytoplasm increases close to the lytic limit of the cellular membrane, the channel opens to release solutes and prevent cell lysis . The exact molecular mechanism of tension sensing involves conformational changes in the transmembrane helices that lead to pore opening.

How can researchers identify and confirm MscL expression in L. sakei strains?

Identification and confirmation of MscL expression in L. sakei can be accomplished through multiple complementary approaches:

  • Gene identification: PCR amplification using primers designed based on conserved regions of mscL genes from related lactic acid bacteria

  • Protein detection: Western blotting using antibodies targeting conserved epitopes of MscL proteins

  • Functional assays: Patch-clamp studies similar to those conducted with L. lactis to detect mechanosensitive channel activity

  • Comparative genomics: Analysis of the L. sakei genome using bioinformatics tools to identify mscL homologs based on sequence similarity to known MscL sequences from lactic acid bacteria

The most definitive confirmation comes from combining genetic identification with functional characterization using electrophysiological methods to verify channel activity.

How does the genetic diversity of L. sakei strains affect MscL structure and function?

The genetic diversity observed across L. sakei strains likely impacts MscL structure and function. MLST analysis has revealed that L. sakei comprises three distinct lineages with different evolutionary histories influenced by independent selection scenarios . Lineage 1 shows evidence of extensive homologous recombination, while lineage 2 is characterized by a high degree of clonality, and lineage 3 shows both clonality and recombination .

This genetic diversity may lead to:

  • Structural variations: Amino acid substitutions that affect channel gating thresholds

  • Functional adaptations: Differences in tension sensitivity reflecting adaptation to specific environmental niches

  • Regulatory differences: Variations in expression patterns in response to environmental stressors

Researchers should consider these lineage-specific differences when selecting L. sakei strains for mechanosensitive channel studies, as MscL properties may vary significantly between strains from different lineages.

What are the optimal protocols for cloning and expressing recombinant L. sakei MscL?

For successful cloning and expression of recombinant L. sakei MscL, researchers should consider the following methodological approach:

Cloning strategy:

  • Amplify the mscL gene from L. sakei genomic DNA using high-fidelity DNA polymerase

  • Insert the amplified gene into an expression vector with a suitable promoter for the host system

  • For bacterial expression, pET vectors with T7 promoters provide high-level expression control

  • Include a purification tag (His6, GST, or MBP) to facilitate subsequent protein isolation

Expression systems:

  • E. coli: The most common host for initial characterization, with BL21(DE3) or C43(DE3) strains recommended for membrane protein expression

  • L. lactis: A gram-positive host more closely related to L. sakei that may provide better folding conditions

  • Homologous expression: Using L. sakei itself for expression, which may require development of specific genetic tools

Expression conditions:

  • Lower induction temperatures (16-25°C) to improve proper folding and membrane insertion

  • Induction at mid-log phase (OD600 ≈ 0.6-0.8)

  • Extended expression periods (16-24 hours) at reduced temperature

  • Addition of glycine betaine (1-2 mM) as an osmolyte to stabilize the protein during expression

These approaches have been successfully applied to similar mechanosensitive channels in related bacteria and can be adapted specifically for L. sakei MscL.

How can electrophysiological techniques be optimized for studying L. sakei MscL function?

Optimization of electrophysiological techniques for studying L. sakei MscL involves several critical considerations:

Patch-clamp methodology:

  • Preparation of giant E. coli spheroplasts: When expressing L. sakei MscL in E. coli, prepare spheroplasts following protocols established for mechanosensitive channel studies

  • Giant liposome reconstitution: Purify the channel protein and reconstitute it into liposomes of defined lipid composition for controlled studies

  • Pipette preparation: Use borosilicate glass pipettes with resistances of 3.5-5.5 MΩ for optimal seal formation

  • Seal formation: Apply gentle suction (20-40 mmHg) to achieve gigaohm seals

Recording parameters:

  • Holding potential: Typically -20 to +20 mV for MscL recordings

  • Pressure application: Apply negative pressure to the patch pipette using a calibrated pressure transducer

  • Solution composition: Use symmetric solutions with 200-400 mM KCl, 90 mM MgCl2, 10 mM CaCl2, and 5 mM HEPES (pH 7.2) for optimal channel conductance

Analysis approaches:

  • Determine pressure thresholds for channel opening

  • Measure single-channel conductance

  • Analyze subconductance states

  • Evaluate pressure-response curves

Based on studies with L. lactis MscL, expect to observe large-conductance channel activity with properties similar to those reported for L. lactis (large unitary conductance and activation by membrane tension) .

What expression systems are most effective for studying recombinant L. sakei MscL?

Comparative analysis of expression systems for studying L. sakei MscL reveals specific advantages and challenges:

Expression SystemAdvantagesLimitationsRecommended Applications
E. coli BL21(DE3)High yield, established protocols, commercially available strains, easy genetic manipulationMight not provide native-like membrane environment, potential toxicity, inclusion body formationInitial characterization, mutagenesis studies, high-throughput screening
E. coli C43(DE3)Enhanced tolerance for membrane proteins, reduced toxicityLower yield compared to BL21(DE3), slower growthExpression of toxic or difficult-to-express MscL variants
L. lactis NZ9000Gram-positive host, more native-like membrane environment, NICE expression system for tight controlLower yields, more complex media requirements, fewer genetic toolsFunctional studies requiring native-like membrane environment
Homologous L. sakei expressionNative membrane environment, authentic post-translational modificationsLimited genetic tools, potential regulatory challenges, difficulty in overexpressionStudies focusing on physiological relevance, in vivo function
Cell-free expressionAvoids toxicity issues, rapid, amenable to incorporation of modified amino acidsLower yields, expensive, requires optimization for membrane proteinsDirected evolution studies, incorporation of unnatural amino acids

Based on experiences with similar proteins, a hybrid approach is often most effective: initial characterization and mutagenesis in E. coli, followed by more detailed functional studies in gram-positive hosts or reconstituted systems that better represent the native environment.

How does L. sakei MscL function compare with MscL channels in other lactic acid bacteria?

Comparative analysis reveals both similarities and differences between MscL channels across lactic acid bacteria:

The MscL channel in L. lactis has been well-characterized and serves as the principal mechanosensitive channel for protection during osmotic downshift . Patch-clamp studies have confirmed that the L. lactis mscL gene encodes a functional MscL-like channel when expressed in E. coli or when reconstituted in proteoliposomes . Furthermore, L. lactis cells with mscL disruption show compromised survival during osmotic downshifts and retain higher levels of glycine betaine (40% versus 20% in wild-type cells) .

For L. sakei MscL, we can expect:

  • Similar core functions in osmoregulation based on evolutionary conservation

  • Potential differences in activation thresholds based on the specific environmental niches occupied by different L. sakei lineages

  • Variation in channel properties reflecting the genetic diversity observed across L. sakei strains

The evolutionary divergence of L. sakei into three distinct lineages suggests that MscL properties might vary between lineages, potentially reflecting adaptation to different environmental reservoirs. This hypothesis could be tested by comparing MscL function across representative strains from each lineage.

What role does MscL play in L. sakei membrane vesicle formation and function?

The relationship between MscL and membrane vesicle (MV) formation in L. sakei represents an intriguing area for investigation:

L. sakei subsp. sakei NBRC15893 has been shown to produce spherical membrane vesicles with diameters of 30-400 nm that contain proteins and nucleic acids . These MVs exhibit immunomodulatory effects, including enhancement of IgA production by murine Peyer's patch cells through activation of Toll-like receptor 2 (TLR2) signaling .

The potential role of MscL in MV formation and function may include:

  • MV biogenesis: MscL might contribute to MV formation through localized disruption of membrane-peptidoglycan connections during opening events

  • Cargo loading: MscL activation could facilitate selective loading of cytoplasmic components into forming MVs

  • MV size regulation: The large pore formed by MscL might influence MV diameter during formation

  • MV release control: MscL activity during osmotic fluctuations could regulate the timing and quantity of MV release

Experimental approaches to investigate this relationship could include:

  • Comparing MV production in wild-type and mscL knockout strains

  • Examining MV composition from strains expressing modified MscL variants

  • Analyzing the co-localization of MscL with MV formation sites using fluorescent protein fusions

The immunomodulatory effects of L. sakei MVs suggest that understanding the relationship between MscL and MV formation could provide insights into both bacterial physiology and host-microbe interactions.

How can site-directed mutagenesis be employed to understand L. sakei MscL gating mechanisms?

Site-directed mutagenesis provides a powerful approach for dissecting the molecular determinants of L. sakei MscL channel gating:

Strategic mutation targets:

  • Transmembrane domains: Mutations in TM1 and TM2 helices can alter hydrophobic interactions that stabilize the closed state

  • Gate region: Mutations in the constriction point (likely involving hydrophobic residues) can modify energy barriers to opening

  • Tension sensor regions: Mutations at the lipid-protein interface can alter sensitivity to membrane tension

  • Cytoplasmic domains: Modifications to C-terminal regions can affect adaptation responses

Experimental design for mutagenesis studies:

  • Generate single point mutations using standard PCR-based site-directed mutagenesis

  • Express mutant channels in appropriate host systems (E. coli or L. lactis)

  • Characterize channel properties using patch-clamp electrophysiology

  • Measure functional parameters:

    • Activation threshold (pressure required for opening)

    • Channel conductance

    • Opening and closing kinetics

    • Subconductance states

Analysis approaches:

  • Construct pressure-response curves for each mutant

  • Calculate energy differences between closed and open states

  • Develop structure-function relationships based on mutation effects

  • Integrate findings into molecular models of channel gating

Based on studies of MscL in other bacteria, expect to identify critical residues that form hydrophobic interactions maintaining the closed state, as well as regions that interact directly with the lipid bilayer to sense membrane tension.

How do environmental conditions affect L. sakei MscL expression and function?

Environmental factors significantly influence MscL expression and function in L. sakei, with important implications for experimental design:

Osmolarity effects:

  • Growth in high osmolarity conditions may upregulate MscL expression as a protective mechanism

  • Osmotic fluctuations can alter membrane properties, affecting MscL gating thresholds

  • Experimental protocols should control and document media osmolarity for reproducible results

Temperature influences:

  • L. sakei lineages may show different temperature adaptations for MscL function

  • Temperature affects membrane fluidity, which can directly impact MscL activation thresholds

  • Standardizing temperature conditions is critical for comparing results across studies

pH considerations:

  • Acidic environments (common in L. sakei habitats) may modify protein-lipid interactions

  • The charged residues in MscL that interact with membrane lipids can be affected by pH changes

  • pH should be monitored and controlled in experimental protocols

Growth phase dependencies:

  • MscL expression may vary with growth phase, potentially increasing during stationary phase

  • Cell size and membrane properties change with growth phase, affecting tension sensing

  • Standardize cell harvesting points when comparing MscL properties across conditions

These environmental factors may differentially affect MscL function across the three identified L. sakei lineages , potentially contributing to their ecological specialization to different environmental reservoirs.

What is the relationship between MscL and osmotic stress response in different L. sakei lineages?

The relationship between MscL and osmotic stress response likely varies across the three evolutionary lineages of L. sakei:

Lineage-specific adaptations:

  • Lineage 1 (panmictic subpopulation with high recombination rates ): May show greater variability in MscL-mediated osmotic responses due to genetic diversity

  • Lineage 2 (highly clonal ): May exhibit more conserved MscL function with potentially specialized adaptation to specific osmotic conditions

  • Lineage 3 (earliest-diverging branch with evidence of both clonality and recombination ): May represent ancestral MscL function with intermediate properties

Experimental evidence from related species:
In L. lactis, MscL serves as the principal mechanosensitive channel for osmotic protection, with mscL disruption mutants showing compromised survival during osmotic downshifts and altered solute retention patterns . Wild-type L. lactis cells retain approximately 20% of internalized glycine betaine after osmotic downshift, while mscL disruption mutants retain about 40% , indicating MscL's critical role in solute release during hypoosmotic shock.

Research strategy for lineage comparison:

  • Select representative strains from each L. sakei lineage

  • Generate isogenic mscL mutants in each background

  • Compare osmotic survival, solute retention, and electrophysiological properties

  • Correlate functional differences with genetic variations in the mscL gene and surrounding regulatory regions

This comparative approach could reveal how evolutionary history has shaped MscL function across L. sakei lineages and provide insights into the role of MscL in niche adaptation.

What computational approaches can model L. sakei MscL structure and dynamics?

Modern computational techniques provide powerful tools for investigating L. sakei MscL structure and dynamics:

Homology modeling approaches:

  • Use crystal structures of MscL from other bacteria (e.g., Mycobacterium tuberculosis) as templates

  • Apply sequence alignments to map L. sakei MscL-specific residues onto the template structure

  • Refine models using energy minimization and molecular dynamics simulations

  • Validate structural predictions through comparison with experimental data

Molecular dynamics simulations:

  • Equilibrium simulations: Probe stable conformations and hydrogen bonding networks

  • Steered molecular dynamics: Apply forces to simulate membrane tension and observe channel opening

  • Coarse-grained simulations: Access longer timescales to observe complete gating transitions

  • Membrane composition effects: Simulate MscL in membranes of varying lipid composition to understand environmental adaptations

Simulation parameters for MscL studies:

  • System size: Typically 100,000-300,000 atoms including protein, membrane, water, and ions

  • Simulation time: 100-500 ns for equilibrium, 1-5 μs for gating transitions

  • Force fields: CHARMM36 or AMBER for all-atom simulations, MARTINI for coarse-grained approaches

  • Analysis metrics: Channel radius, pore hydration, lipid-protein interactions, subunit interactions

These computational approaches can generate testable hypotheses about residues critical for L. sakei MscL function and suggest targets for site-directed mutagenesis experiments.

How can proteoliposome reconstitution be optimized for functional studies of L. sakei MscL?

Optimizing proteoliposome reconstitution is critical for obtaining reliable functional data on L. sakei MscL:

Lipid composition considerations:

  • Native-like mixtures: Include phosphatidylethanolamine, phosphatidylglycerol, and cardiolipin to mimic bacterial membranes

  • Lipid chain length: C16-C18 phospholipids typically provide optimal hydrophobic matching with MscL

  • Membrane fluidity: Adjust unsaturation levels to maintain appropriate fluidity at experimental temperatures

  • Systematic testing: Compare channel function in different lipid compositions to identify optimal conditions

Reconstitution protocols:

  • Detergent removal methods:

    • Dialysis (gentle but time-consuming)

    • Bio-Beads (faster but potential protein loss)

    • Dilution (simple but may result in heterogeneous vesicles)

  • Protein:lipid ratios:

    • Low ratios (1:1000-1:5000) for single-channel studies

    • Higher ratios (1:100-1:500) for ensemble measurements

    • Validate ratios by freeze-fracture electron microscopy

  • Quality control criteria:

    • Size distribution (dynamic light scattering)

    • Protein orientation (protease protection assays)

    • Channel functionality (fluorescent dye release assays)

Advanced approaches:

  • Droplet interface bilayers: For high-throughput electrophysiology

  • Supported lipid bilayers: For combined electrophysiology and microscopy

  • Nanodiscs: For structural studies of MscL in a membrane environment

Optimization of these parameters will enable more reliable functional characterization of L. sakei MscL and facilitate comparison with MscL channels from other bacteria.

What emerging technologies show promise for studying L. sakei MscL dynamics and function?

Several cutting-edge technologies offer new opportunities for studying L. sakei MscL:

Advanced structural techniques:

  • Cryo-electron microscopy: Can capture different conformational states of MscL at near-atomic resolution

  • Single-particle analysis: Enables visualization of structural heterogeneity in different functional states

  • Mass spectrometry coupled with crosslinking: Identifies residue interactions in different conformational states

  • Hydrogen-deuterium exchange mass spectrometry: Maps solvent accessibility changes during gating

Real-time dynamics measurements:

  • Single-molecule FRET: Measures distances between labeled residues during channel gating

  • High-speed atomic force microscopy: Observes conformational changes in membrane proteins with nanometer resolution

  • Site-directed spin labeling with EPR: Detects local environmental changes during channel activation

  • Fluorescence correlation spectroscopy: Monitors protein dynamics in membrane environments

Functional assays with increased throughput:

  • Fluorescence-based liposome flux assays: Enable parallel testing of multiple MscL variants

  • Microfluidic patch-clamp devices: Increase throughput of electrophysiological recordings

  • Optogenetic approaches: Allow light-controlled activation of mechanosensitive channels

  • In vivo tension sensors: Report on membrane tension in living cells

These emerging technologies will enable researchers to develop more comprehensive models of L. sakei MscL function and its role in bacterial physiology, potentially revealing unique adaptations across the three evolutionary lineages identified in L. sakei populations .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.