Recombinant Lactobacillus sakei subsp. sakei Protein CrcB homolog 2 (crcB2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline for your use.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us; we will prioritize its implementation.
Synonyms
crcB2; LCA_0136; Putative fluoride ion transporter CrcB 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-115
Protein Length
full length protein
Species
Lactobacillus sakei subsp. sakei (strain 23K)
Target Names
crcB2
Target Protein Sequence
MTILLVGLGAALGAILRYQLTRIGNHIASEFPLMTFLINLTGSFCLGWLTGSQLSQPVTL FLGVGVLGGYTTFSTLNSELSQLWFRRRYHIFFGYWLLTYGLGLLVAAAGFYAGL
Uniprot No.

Target Background

Function

Crucial for reducing intracellular fluoride concentration, thereby mitigating its toxicity.

Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is CrcB homolog 2 in Lactobacillus sakei and how is it identified?

CrcB homolog 2 (crcB2) in Lactobacillus sakei is a putative membrane protein that likely functions in fluoride ion channel activity, similar to its homologs in other bacterial species. The protein is typically identified through genomic sequencing and subsequent bioinformatic analysis using tools that incorporate sequence homology, protein domain identification, and phylogenetic analysis.

For identification and characterization, researchers typically employ a multi-step process:

  • Whole genome sequencing of L. sakei strains

  • Gene prediction and annotation using specialized bacterial annotation pipelines like Bakta

  • Homology-based identification using BLAST against known CrcB proteins

  • Protein domain analysis using tools like InterProScan or Pfam

  • Comparative genomic analysis across different L. sakei strains

Recent comparative genomic analysis of 30 complete L. sakei genomes revealed substantial core genome alongside a diverse genetic repertoire, indicating both high genetic conservation and adaptability across strains . This genomic diversity suggests potential functional variations in proteins like CrcB2 that warrant further investigation.

What is currently known about the genomic context of crcB2 in L. sakei?

The genomic context of crcB2 in L. sakei remains an area requiring dedicated research, as specific information about this gene's organization is not extensively documented. Based on genomic patterns observed in other bacteria and recent comprehensive analyses of the L. sakei genome, several key observations can be made:

  • The L. sakei genome size ranges from 1.88 Mbp (strain 23K) to 2.12 Mbp (strain WiKim0095) with an average of 2.02 Mb

  • The average G+C content is approximately 41.14%, ranging from 40.97% to 41.31% across strains

  • Pan-genome analysis indicates that as the number of L. sakei strains increases, the number of pan-genes continuously increases while core genes tend to stabilize

For researchers investigating crcB2, it would be valuable to analyze:

  • Whether crcB2 is part of the core genome or accessory genome of L. sakei

  • If crcB2 is located on the chromosome or potentially on one of the plasmids identified in L. sakei strains

  • Whether crcB2 is part of an operon or gene cluster that might suggest functional relationships

What are the predicted structural characteristics of CrcB2 protein?

While specific structural data for L. sakei CrcB2 protein has not been extensively reported, predictions can be made based on homologous proteins in other bacteria:

CrcB proteins typically feature:

  • Multiple transmembrane domains (usually 3-4 transmembrane helices)

  • A size of approximately 120-150 amino acids

  • Conserved amino acid residues critical for fluoride ion coordination

  • A characteristic fold that creates an ion channel pore through the membrane

To validate these predictions for L. sakei CrcB2, researchers should consider:

  • Computational structural prediction using tools like AlphaFold2 or RoseTTAFold

  • Hydropathy analysis to confirm transmembrane regions

  • Comparison with experimentally determined structures of CrcB proteins from other organisms

  • Identification of conserved residues through multiple sequence alignment

What methodological approaches can be used to express and purify recombinant CrcB2 from L. sakei?

Expressing and purifying membrane proteins like CrcB2 presents significant challenges that require specialized approaches. A comprehensive methodology would include:

Expression System Selection:

  • E. coli-based systems (BL21(DE3), C41/C43 strains specifically designed for membrane proteins)

  • Cell-free expression systems that can accommodate membrane proteins

  • Yeast expression systems (P. pastoris) for complex proteins requiring eukaryotic folding machinery

Optimization Protocol:

  • Construct design with appropriate affinity tags (His6, FLAG, or Strep-tag II)

  • Codon optimization for the expression host

  • Temperature optimization (typically lower temperatures of 16-25°C to prevent inclusion body formation)

  • Inducer concentration titration (IPTG, arabinose, etc.)

  • Expression time optimization

Membrane Protein Solubilization and Purification:

  • Membrane isolation through differential centrifugation

  • Solubilization screening with various detergents:

    • Mild detergents (DDM, LMNG, LDAO)

    • Lipid-like detergents (Fos-choline derivatives)

    • Newer amphipols or SMALPs for native-like environments

  • Affinity chromatography under optimized detergent conditions

  • Size exclusion chromatography for final purification and buffer exchange

Quality Control Measures:

  • Western blotting to confirm identity

  • Circular dichroism to verify secondary structure

  • Dynamic light scattering to assess homogeneity

  • Thermal stability assays to optimize buffer conditions

How can researchers investigate the functional role of CrcB2 in L. sakei's environmental adaptation?

Investigating CrcB2's role in L. sakei adaptation requires a multifaceted approach combining genetics, physiology, and molecular biology:

Genetic Manipulation Approaches:

  • CRISPR-Cas9 gene editing (three L. sakei strains were identified with CRISPR-Cas systems that could potentially be leveraged for gene editing)

  • Homologous recombination-based gene deletion

  • Antisense RNA or CRISPR interference for gene knockdown

  • Complementation studies with wild-type and mutant variants

Physiological Characterization:

  • Growth assays under varying fluoride concentrations

  • Survival rate determination in acidic environments containing fluoride

  • Competition assays between wild-type and crcB2 mutants

  • Adaptation studies in meat fermentation environments with varying fluoride levels

Molecular Analysis:

  • Transcriptomic analysis to identify co-expressed genes

  • Proteomic analysis to detect protein-protein interactions

  • Fluoride uptake assays using fluoride-sensitive probes

  • Electrophysiology to confirm ion channel activity

Researchers should note that L. sakei strains demonstrate significant genetic diversity as revealed by comparative genomic analysis , which may result in functional variations of CrcB2 across strains. Additionally, the presence of plasmids in 22 of 30 analyzed strains suggests potential horizontal gene transfer mechanisms that could influence CrcB2 evolution and function.

What approaches can be used to investigate potential interactions between CrcB2 and other proteins in L. sakei?

Investigating protein interactions involving CrcB2 requires techniques optimized for membrane proteins. Recommended approaches include:

In vivo Interaction Studies:

  • Bacterial two-hybrid systems adapted for membrane proteins

  • Split-protein complementation assays (split-GFP, split-luciferase)

  • In vivo crosslinking followed by co-immunoprecipitation

  • Proximity-dependent biotin labeling (BioID or TurboID adapted for bacterial systems)

In vitro Interaction Analysis:

  • Pull-down assays using purified CrcB2 with appropriate detergent or lipid nanodisc systems

  • Surface plasmon resonance (SPR) for quantitative binding analysis

  • Microscale thermophoresis for detecting interactions in solution

  • Native mass spectrometry for intact complex analysis

Computational Prediction:

  • Co-evolution analysis to identify potential interaction partners

  • Protein-protein docking simulations

  • Analysis of genomic context and operon structure

  • Identification of conserved protein complexes across related species

Functional Validation:

  • Co-expression and phenotype analysis of potential interacting partners

  • Mutational analysis of predicted interaction interfaces

  • Fluoride sensitivity assays with interaction-disrupting mutations

  • Comparative analysis across L. sakei strains with differing environmental adaptations

Researchers should consider the known ability of L. sakei to adapt to various environments, including fermented foods, meat products, and the human gastrointestinal tract , when investigating potential protein interactions, as these adaptations may influence the interaction partners of CrcB2.

How should researchers design experiments to investigate CrcB2 function in fluoride resistance?

Investigating CrcB2's role in fluoride resistance requires a systematic experimental design approach:

Experimental Design Framework:

  • Hypothesis Formulation

    • Primary hypothesis: CrcB2 functions as a fluoride exporter in L. sakei

    • Alternative hypothesis: CrcB2 serves a different ion transport function or has a novel role

  • Strain Selection and Construction

    • Wild-type L. sakei strains from diverse sources (the 30 complete genome strains provide excellent candidates)

    • crcB2 deletion mutants (ΔcrcB2)

    • Complemented strains (ΔcrcB2 + plasmid-encoded crcB2)

    • Point mutants in predicted functional residues

  • Growth Inhibition Assays

    • Minimum inhibitory concentration (MIC) determination for fluoride

    • Growth curves at various fluoride concentrations (0-50 mM)

    • Competition assays between wild-type and mutant strains

    • Cross-resistance testing with other halides

  • Molecular Transport Assays

    • Fluoride uptake using fluoride-selective electrodes

    • Intracellular fluoride measurement using fluorescent probes

    • Membrane vesicle transport assays

    • Heterologous expression in fluoride-sensitive indicator strains

Control Considerations:

  • Positive controls: Known fluoride exporters from other bacteria

  • Negative controls: Strains lacking any CrcB homologs

  • Environmental controls: Standardized media composition and pH

  • Genetic controls: Complementation with crcB from other species

Data Analysis Approach:

  • Dose-response curve modeling

  • Comparative statistical analysis of growth parameters

  • Kinetic analysis of fluoride transport

  • Integration of phenotypic and genotypic data across strains

This experimental framework accounts for the genetic diversity observed in L. sakei strains and allows for correlation of CrcB2 function with strain-specific adaptations.

What are the optimal methods for analyzing the expression patterns of crcB2 across different environmental conditions?

Understanding crcB2 expression patterns under various conditions requires a combination of transcriptomic and proteomic approaches:

Transcriptomic Analysis:

  • RT-qPCR Protocol:

    • Target gene: crcB2

    • Reference genes: At least 3 validated housekeeping genes for L. sakei

    • RNA extraction: Optimized protocol for L. sakei considering cell wall structure

    • Primer design: Specific primers spanning exon-exon junctions if applicable

    • Data normalization: Using validated reference genes and appropriate algorithms

  • RNA-Seq Analysis:

    • Sample preparation: Strand-specific library preparation

    • Sequencing depth: Minimum 20 million reads per sample

    • Biological replicates: At least 3 per condition

    • Differential expression analysis: DESeq2 or EdgeR with appropriate FDR correction

    • Co-expression network analysis to identify gene clusters

Proteomic Analysis:

  • Western Blotting:

    • Antibody production: Custom antibodies against CrcB2 or epitope-tagged versions

    • Protein extraction: Optimized protocols for membrane proteins

    • Quantification: Densitometry with appropriate normalization

  • Mass Spectrometry:

    • Sample preparation: Specialized membrane protein extraction

    • Labeling strategies: TMT or iTRAQ for multiplexed analysis

    • Targeted proteomics: PRM or MRM assays for specific quantification

    • Data analysis: Linear mixed models with appropriate normalization

Environmental Conditions to Test:

Condition CategorySpecific ParametersRelevance to L. sakei Ecology
pH variationpH 4.0, 5.5, 7.0Fermentation environments
Temperature10°C, 25°C, 37°CMeat storage, fermentation, GI tract
NaCl concentration0%, 2%, 6%Food preservation conditions
Fluoride levels0, 5, 10, 25 mMPotential inducer of crcB2
Growth phaseEarly, mid, late exponential, stationaryTemporal regulation
Substrate variationGlucose, ribose, meat extractCarbon source adaptation
Oxygen levelsAerobic, microaerobic, anaerobicEnvironmental adaptation

This comprehensive approach will provide insights into the regulatory mechanisms controlling crcB2 expression and how they relate to L. sakei's ability to adapt to diverse environments including fermented foods, meat products, and the human gastrointestinal tract .

What techniques can be applied to study the impact of crcB2 mutations on L. sakei fitness and adaptation?

Studying the impact of crcB2 mutations requires a comprehensive approach combining evolutionary, genetic, and phenotypic analyses:

Mutation Generation Strategies:

  • Site-Directed Mutagenesis:

    • Target conserved residues identified through multiple sequence alignment

    • Create point mutations in predicted functional domains

    • Generate truncation variants to identify essential regions

    • Design chimeric proteins with other ion transporters

  • Random Mutagenesis:

    • Error-prone PCR with controlled mutation rates

    • Transposon mutagenesis libraries

    • CRISPR-based saturation mutagenesis

    • Leveraging natural variations found in comparative genomic analysis

Fitness Assessment Methods:

  • Growth and Survival Analysis:

    • Growth rate determination under various stress conditions

    • Long-term survival assays

    • Competition assays with wild-type strains (mixed cultures)

    • Fitness measurements using barcode sequencing

  • Experimental Evolution:

    • Serial passage under increasing fluoride stress

    • Whole genome sequencing to identify compensatory mutations

    • Fitness landscape mapping

    • Reverse genetics to validate evolved mutations

Adaptation Analysis:

  • Metabolic Phenotyping:

    • Biolog phenotype microarrays for metabolic profiling

    • Metabolomics analysis under fluoride stress

    • Energy charge measurements

    • Membrane potential analysis

  • Stress Response Characterization:

    • Transcriptomic analysis of stress response pathways

    • Proteome-wide changes in response to fluoride

    • Cross-protection against other stressors

    • Biofilm formation assays

Quantitative Measures of Fitness:

Fitness ParameterMeasurement MethodExpected Impact of crcB2 Mutation
Maximum growth rate (μmax)Growth curve analysisReduced under fluoride stress
Lag phase durationTime-to-detection analysisExtended under fluoride stress
Competitive indexMixed culture experimentsDecreased relative to wild-type
Survival rateViable count determinationsReduced after fluoride exposure
Minimal inhibitory concentrationBroth dilution methodLower for fluoride
Mutation frequencyFluctuation analysisPotentially elevated under stress
Metabolic efficiencyYield coefficientsDecreased under fluoride stress

This approach aligns with findings that L. sakei strains have developed various adaptations to thrive in different environments , allowing researchers to contextualize the role of CrcB2 within the broader adaptive strategies of this species.

How should researchers interpret contradictory results in CrcB2 functional studies across different L. sakei strains?

Contradictory results across L. sakei strains are likely reflective of the species' genetic diversity and strain-specific adaptations . A systematic approach to interpreting such contradictions includes:

Sources of Variation Analysis:

  • Genomic Context Evaluation:

    • Compare genome organization around crcB2 in different strains

    • Identify presence/absence of auxiliary genes that might complement CrcB2 function

    • Assess copy number variations or paralogous genes

    • Evaluate promoter regions for regulatory differences

  • Evolutionary Analysis:

    • Phylogenetic analysis to determine if contradictory results correlate with evolutionary clades (the three distinct clades identified in recent analysis )

    • Selection pressure analysis on crcB2 across strains

    • Horizontal gene transfer assessment

    • Identification of recombination events

  • Functional Redundancy Investigation:

    • Assess presence of alternative fluoride resistance mechanisms

    • Examine compensatory pathways that might mask crcB2 phenotypes

    • Perform double knockout studies to identify redundant systems

    • Compare with plasmid-encoded functions that might complement chromosomal genes

Reconciliation Strategies:

  • Standardized Testing Framework:

    • Develop consensus experimental protocols across laboratories

    • Use identical growth conditions and media formulations

    • Apply consistent stress parameters and measurement techniques

    • Implement calibrated analytical methods

  • Multi-strain Comparative Analysis:

    • Test a panel of well-characterized L. sakei strains in parallel

    • Include representative strains from each of the three phylogenetic clades

    • Create isogenic strains differing only in crcB2 alleles

    • Perform complementation tests across strains

Interpretation Framework:

Contradiction TypePotential ExplanationResolution Approach
Strain-specific phenotypesGenetic background effectsTest crcB2 allele swapping between strains
Variable fluoride sensitivityDifferent transport systemsComprehensive transport assays with multiple ions
Inconsistent expression patternsRegulatory network variationsCompare transcriptional landscapes
Functional divergenceAdaptive evolutionStructure-function analysis of protein variants
Methodology-dependent resultsTechnical artifactsStandardize protocols across studies

This systematic approach acknowledges the "substantial core genome alongside a diverse genetic repertoire" of L. sakei , providing context for interpreting strain-specific variations in CrcB2 function.

What bioinformatic approaches are most valuable for analyzing CrcB2 homologs across bacterial species?

Comprehensive bioinformatic analysis of CrcB2 homologs requires multi-level approaches that capture evolutionary, structural, and functional aspects:

Sequence-Based Analysis:

  • Homology Identification:

    • Position-Specific Iterative BLAST (PSI-BLAST) to capture distant homologs

    • Hidden Markov Model (HMM) profile searches using HMMER

    • Sensitive search methods like HHpred for remote homology detection

    • Domain architecture analysis using InterProScan

  • Evolutionary Analysis:

    • Maximum likelihood phylogenetic reconstruction with appropriate substitution models

    • Bayesian inference for complex evolutionary scenarios

    • Reconciliation of gene and species trees to identify duplication/loss events

    • Selection pressure analysis using dN/dS ratios

Structural Bioinformatics:

  • Structural Prediction:

    • AI-based structure prediction using AlphaFold2 or RoseTTAFold

    • Transmembrane topology prediction using TMHMM, Phobius, or DeepTMHMM

    • Molecular dynamics simulations to evaluate ion channel properties

    • Electrostatic surface mapping to identify potential ion binding sites

  • Comparative Structural Analysis:

    • Structural alignment of CrcB homologs

    • Identification of conserved structural features across homologs

    • Mapping of conserved residues onto predicted structures

    • Analysis of conformational flexibility in ion channels

Functional Prediction:

  • Genomic Context Analysis:

    • Operon structure prediction across bacterial genomes

    • Gene neighborhood conservation analysis

    • Co-evolution with potential functional partners

    • Correlation with other fluoride resistance genes

  • Integrative Approaches:

    • Machine learning models trained on known ion transporters

    • Network analysis of functionally related proteins

    • Prediction of substrate specificity based on binding site analysis

    • Integration of transcriptomic data with protein features

Specialized Tools for Membrane Protein Analysis:

Analysis TypeRecommended ToolsApplication to CrcB2
Transmembrane topologyTMHMM, TOPCONS, DeepTMHMMPredicting membrane-spanning regions
Lipid interaction sitesPPM server, PLATINUMIdentifying membrane interface residues
Channel predictionHOLE, MOLEonlineAnalyzing potential ion conduction paths
Evolutionary couplingEVfold, RaptorX-ContactPredicting residue contacts for structure validation
Conserved domain analysisCD-Search, InterProScanIdentifying functional motifs

By applying these complementary approaches, researchers can place L. sakei CrcB2 within the broader context of bacterial fluoride transporters and potentially identify unique adaptations that reflect L. sakei's diverse ecological niches, as suggested by the comparative genomic analysis .

How can researchers effectively combine structural and functional data to understand CrcB2 mechanism of action?

Integrating structural and functional data requires a systematic approach to establish structure-function relationships for CrcB2:

Integration Framework:

  • Structure-Guided Mutagenesis:

    • Identify conserved residues through multiple sequence alignment

    • Target predicted ion-coordination sites based on structural models

    • Design mutations that alter channel properties without disrupting folding

    • Create systematic alanine scanning or conservative substitution libraries

  • Functional Mapping:

    • Correlate mutation effects with specific functional parameters

    • Develop quantitative assays for fluoride transport

    • Measure kinetic parameters (Km, Vmax) for wild-type and mutant proteins

    • Assess ion selectivity through competition assays

  • Conformational Analysis:

    • Use EPR spectroscopy with site-directed spin labeling to track conformational changes

    • Apply single-molecule FRET to observe dynamic states

    • Implement crosslinking studies to capture different conformational states

    • Utilize electrophysiology to correlate structure with channel gating

Data Integration Techniques:

  • Computational Methods:

    • Molecular dynamics simulations of ion permeation

    • Quantum mechanics/molecular mechanics (QM/MM) for ion coordination

    • Free energy calculations for ion binding and transport

    • Normal mode analysis for identifying functionally relevant motions

  • Visualization and Modeling:

    • Create integrated structural-functional maps

    • Develop state models correlating structure with transport cycle

    • Implement Markov modeling of channel states

    • Use principal component analysis to identify major conformational changes

Validation Approaches:

Structural FeatureFunctional AssayIntegration Method
Ion binding siteIon affinity measurementsMutational analysis of predicted binding residues
Channel poreConductance measurementsCorrelation of pore diameter with ion flux
Gating elementsTime-resolved transport assaysRelating conformational changes to transport rates
Oligomerization interfaceCrosslinking and analytical ultracentrifugationEffect of interface mutations on function
Lipid interaction surfacesReconstitution in different lipid environmentsImpact of lipid composition on activity

This integrated approach will provide mechanistic insights into how CrcB2 functions in L. sakei and how it contributes to the organism's ability to adapt to diverse environments including fermented foods, meat products, and potentially the human gastrointestinal tract , where fluoride concentrations may vary.

What emerging technologies could enhance our understanding of CrcB2 function and regulation?

Emerging technologies offer new avenues for investigating CrcB2 function and regulation in L. sakei:

Advanced Structural Biology:

  • Cryo-Electron Microscopy:

    • Single-particle analysis for high-resolution structures of CrcB2

    • Tomography of membrane environments containing CrcB2

    • Time-resolved structures capturing different conformational states

    • Visualization of CrcB2 in complex with interaction partners

  • Integrative Structural Approaches:

    • Combining NMR, X-ray crystallography, and cryo-EM data

    • Mass spectrometry-based structural proteomics

    • Hydrogen-deuterium exchange mass spectrometry for dynamics

    • Solid-state NMR for membrane-embedded structures

Genome Engineering and High-Throughput Screening:

  • CRISPR-Based Technologies:

    • Base editors for precise genomic modifications

    • CRISPRi/CRISPRa for tunable gene expression

    • CRISPR-based screening of genetic interactions

    • In vivo evolution using CRISPR-driven mutagenesis

  • Deep Mutational Scanning:

    • Comprehensive mutational libraries of CrcB2

    • Fluoride resistance phenotyping of thousands of variants

    • Machine learning analysis of sequence-function relationships

    • Identification of epistatic interactions within the protein

Advanced Imaging and Single-Molecule Techniques:

  • Super-Resolution Microscopy:

    • PALM/STORM imaging of CrcB2 localization and clustering

    • Single-molecule tracking to observe diffusion and interactions

    • Multi-color imaging to visualize protein complexes

    • Correlative light and electron microscopy

  • Functional Imaging:

    • Fluoride-sensitive fluorescent probes for real-time transport visualization

    • FRET-based sensors for conformational changes

    • Microfluidic approaches for single-cell analysis

    • Label-free imaging technologies for native protein monitoring

Systems Biology and Computational Approaches:

  • Multi-Omics Integration:

    • Combined analysis of transcriptomics, proteomics, and metabolomics

    • Network modeling of fluoride response pathways

    • Flux balance analysis to assess metabolic impact

    • Integration with comparative genomics data across L. sakei strains

  • Advanced Computational Methods:

    • Quantum computing for complex molecular simulations

    • Explainable AI for mechanistic interpretation of data

    • Digital twin models of L. sakei under fluoride stress

    • Protein language models for functional prediction

This diverse set of emerging technologies can be applied to understand how CrcB2 contributes to L. sakei's remarkable adaptability across different environments, as suggested by comparative genomic analysis and studies of its probiotic properties .

What are the potential implications of CrcB2 research for understanding L. sakei adaptation to different ecological niches?

Research on CrcB2 has significant implications for understanding L. sakei's exceptional adaptability to diverse environments:

Ecological Adaptation Mechanisms:

  • Environmental Fluoride Response:

    • Adaptation to varying fluoride levels in different fermentation environments

    • Response to fluoride in meat preservation settings

    • Management of fluoride exposure in the gastrointestinal tract

    • Competitive advantage in high-fluoride ecological niches

  • Membrane Homeostasis:

    • Role in maintaining membrane integrity under stress

    • Contribution to proton motive force maintenance

    • Interaction with other ion transport systems

    • Adaptation to varying pH environments encountered during fermentation

Evolutionary Implications:

  • Selective Pressures:

    • Analysis of CrcB2 sequence variation across the three distinct clades identified in L. sakei

    • Correlation of CrcB2 variants with isolation source and ecological niche

    • Identification of convergent evolution in different strains

    • Assessment of horizontal gene transfer events involving crcB2

  • Functional Diversification:

    • Investigation of potential neofunctionalization in certain lineages

    • Correlation of CrcB2 variants with strain-specific metabolic capabilities

    • Examination of co-evolution with other adaptive traits

    • Relationship to the diverse genetic repertoire observed in pan-genome analysis

Applications Based on Ecological Understanding:

  • Improved Starter Cultures:

    • Selection of strains with optimal CrcB2 variants for specific fermentation applications

    • Engineering of CrcB2 to enhance performance in food fermentation

    • Development of stress-resistant starter cultures based on CrcB2 insights

    • Optimization for meat fermentation environments where L. sakei naturally excels

  • Probiotic Applications:

    • Understanding how CrcB2 contributes to survival in the human GI tract

    • Correlation with immunomodulatory properties observed in rheumatoid arthritis models

    • Enhanced survival during probiotic formulation and storage

    • Potential contribution to competitive exclusion of pathogens

Research Framework for Ecological Studies:

Ecological AspectCrcB2 Research ApproachExpected Insights
Fermented food environmentsComparative analysis across food-isolated strainsAdaptation to food-specific stressors
Meat preservation systemsCrcB2 function under meat-relevant conditionsContribution to starter culture performance
Gastrointestinal adaptationSurvival and activity under GI conditionsRole in probiotic applications
Environmental stress responseMultiplex stress testing with fluoride variablesIntegrated stress response mechanisms
Microbial community interactionsCo-culture experiments with varying CrcB2 functionCompetitive advantage mechanisms

This ecological perspective on CrcB2 aligns with observations that L. sakei strains exhibit significant genetic diversity that allows them to adapt to various environments, including fermented foods, meat products, and potentially the human gastrointestinal tract, as indicated by both comparative genomic and immunological studies .

How might CrcB2 function contribute to the beneficial properties of L. sakei in food fermentation and as a probiotic?

The function of CrcB2 in L. sakei may have significant implications for both food fermentation applications and probiotic benefits:

Food Fermentation Contributions:

  • Enhanced Stress Resistance:

    • Improved survival during fermentation processes with varying pH

    • Better tolerance to preservation methods that might involve fluoride

    • Increased resilience during starter culture production and storage

    • Consistent performance across different meat fermentation environments

  • Meat Fermentation Optimization:

    • Contribution to the bacteriocin-producing capabilities observed in strains like L. sakei CRL1862

    • Potential role in maintaining cellular function during protein hydrolysis processes

    • Support for acid production during fermentation

    • Maintenance of cellular homeostasis during rapid growth phases

Probiotic Potential:

  • Gastrointestinal Survival:

    • Resistance to fluoride encountered in the GI tract from food and water

    • Contribution to acid tolerance required for stomach passage

    • Maintenance of membrane integrity under bile stress

    • Support for competitive fitness against pathogens

  • Immunomodulatory Properties:

    • Potential connection to the observed suppression of collagen-induced arthritis

    • Possible role in maintaining cellular function during modulation of interleukin levels

    • Contribution to survival during interaction with immune cells

    • Support for consistent probiotic function in vivo

Research Priorities for Applications:

  • Fermentation Performance Studies:

    • Correlation of CrcB2 variants with fermentation kinetics

    • Comparative analysis of wild-type and crcB2-modified strains in meat fermentation

    • Assessment of contribution to sensorial attributes of fermented products

    • Evaluation of role in pathogen inhibition observed in strains like L. sakei CRL1862

  • Probiotic Function Investigation:

    • Analysis of CrcB2 contribution to survival in simulated gastrointestinal conditions

    • Assessment of role in immunomodulatory effects observed in arthritis models

    • Evaluation of impact on adhesion to intestinal epithelial cells

    • Investigation of potential influence on microbial community dynamics

Translational Research Framework:

Application AreaResearch ApproachExpected Outcomes
Meat fermentationCrcB2 function under meat-relevant conditionsImproved starter culture performance
Food safety enhancementRole in competitive exclusion of pathogensBetter bioprotective cultures
Probiotic formulationStress resistance during processing and storageMore stable probiotic products
ImmunomodulationContribution to anti-inflammatory properties Enhanced therapeutic applications
Functional food developmentIntegration of fermentation and probiotic benefitsMulti-functional food cultures

This research direction connects CrcB2 function to the observed abilities of L. sakei to prevent the growth of pathogens like Listeria monocytogenes and Staphylococcus aureus , hydrolyze proteins in meat systems , and exhibit immunomodulatory effects in models of rheumatoid arthritis , providing a molecular basis for these beneficial properties.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.