Recombinant Lactobacillus sakei subsp. sakei UPF0756 membrane protein LSA1031 (LSA1031)

What is LSA1031 and what structural characteristics define this protein?

LSA1031 is a membrane protein classified as UPF0756 (uncharacterized protein family 0756) found in Lactobacillus sakei subsp. sakei. The protein consists of 153 amino acids with a characteristic membrane-spanning topology. The full amino acid sequence is: MESWLFLAAILIVALLAKNQSLIIATAVVLVLKALPISEKVLPVIQAKGINWGVTVISVAILVPIATGQIGFKELISAFKTPAGFIAVGCGVLVAVLSAKGVGLLAASPEMTVALVFGTIMGVVFLKGIAAGPVIAAGITYTILTIFNLVPIH . This sequence reveals hydrophobic regions typical of membrane proteins, which are crucial for its integration into the bacterial cell membrane. Based on its sequence properties, LSA1031 likely contains multiple transmembrane domains that anchor it within the lipid bilayer, which is consistent with its classification as a membrane protein.

The protein is part of a group of membrane proteins that may be involved in adaptation mechanisms of Lactobacillus sakei to environmental stresses, though its specific function has not been fully characterized. Structural predictions suggest it may participate in transport processes or cell signaling pathways related to stress response, which is particularly relevant given Lactobacillus sakei's ability to adapt to various environmental conditions .

What is the optimal expression system for recombinant LSA1031 production?

Escherichia coli represents the optimal expression system for recombinant LSA1031 production based on current methodologies. The full-length protein (comprising amino acids 1-153) has been successfully expressed in E. coli with an N-terminal His-tag to facilitate purification . This expression system balances efficiency with cost-effectiveness while producing sufficient quantities of functional protein for research applications.

When expressing LSA1031, several considerations must be addressed:

• Codon optimization may be necessary to account for differences in codon usage bias between Lactobacillus sakei and E. coli

• Expression temperature and induction conditions require optimization to prevent inclusion body formation

• The presence of the His-tag at the N-terminus appears to maintain protein functionality while enabling affinity purification

• Specialized E. coli strains designed for membrane protein expression may improve yields

The expression protocol typically involves transformation of the optimized construct into an appropriate E. coli strain, followed by culture growth to mid-log phase before induction, with subsequent growth at reduced temperature to promote proper protein folding. This methodology has been validated to produce recombinant LSA1031 with greater than 90% purity as determined by SDS-PAGE analysis .

What reconstitution and storage protocols are recommended for LSA1031?

The reconstitution of lyophilized LSA1031 protein requires careful handling to maintain structural integrity and functionality. The recommended protocol follows specific parameters to ensure optimal protein stability and activity:

• Brief centrifugation of the protein vial prior to opening is essential to bring all contents to the bottom

• The protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL

• Addition of glycerol to a final concentration of 5-50% (optimally 50%) is recommended for long-term storage

• The reconstituted protein should be aliquoted to minimize freeze-thaw cycles

• Storage should be maintained at -20°C to -80°C for extended periods

For working solutions, aliquots can be stored at 4°C for up to one week, but repeated freeze-thaw cycles should be strictly avoided as they significantly compromise protein integrity. The storage buffer consists of a Tris/PBS-based solution with 6% trehalose at pH 8.0, which has been optimized to maintain protein stability .

For researchers conducting structural studies or functional assays, it is advisable to perform reconstitution immediately before use rather than storing reconstituted protein for extended periods. When working with membrane proteins like LSA1031, inclusion of appropriate detergents or lipids during reconstitution may be necessary depending on the specific experimental application.

What experimental approaches are most effective for characterizing LSA1031 function?

Characterizing the function of LSA1031 requires a multi-faceted experimental approach that combines genetic, biochemical, and structural methodologies. Based on established research protocols for membrane proteins and specific studies on Lactobacillus species, the following methodological framework is recommended:

Genetic Approaches:

• Construction of knockout mutants using homologous recombination with integrative plasmids like pRV300

• PCR-based verification of genetic structure in mutants

• Complementation studies to confirm phenotype restoration

• Site-directed mutagenesis of conserved residues to identify functional domains

Phenotypic Characterization:

• Growth curve analysis under various environmental conditions (temperature, pH, salt concentration)

• Survival rate determination during stationary phase at low temperatures

• Comparative analysis of cellular physiology between wild-type and mutant strains

• Stress challenge assays to evaluate specific adaptive responses

Biochemical and Structural Studies:

• Protein-protein interaction studies using pull-down assays with the His-tagged recombinant protein

• Membrane localization confirmation using fractionation and Western blotting

• Functional reconstitution in liposomes to assess transport or signaling activities

• Structural characterization using techniques suitable for membrane proteins

The effectiveness of these approaches has been demonstrated in related studies with L. sakei proteins involved in stress adaptation, where phenotypic effects were observed in five out of six mutants constructed for stress-response genes when grown at low temperatures . This methodological framework provides a comprehensive strategy for elucidating the functional role of LSA1031 in L. sakei physiology and stress adaptation.

How does LSA1031 compare to homologous proteins in other lactic acid bacteria?

Comparative analysis of LSA1031 with homologous proteins in other lactic acid bacteria reveals evolutionary conservation patterns that provide insights into its functional significance. Sequence alignment and phylogenetic analysis indicate that LSA1031 belongs to the UPF0756 family of membrane proteins, which are widely distributed among Lactobacillales but remain functionally uncharacterized.

The protein shows significant sequence homology to membrane proteins in related species, particularly within the Lactobacillus genus. This conservation suggests a fundamental role in cellular physiology that has been maintained throughout evolutionary divergence of these species. Comparative analysis reveals:

• Conservation of transmembrane domain architecture across Lactobacillus species

• Variation in specific residues that may reflect adaptation to different ecological niches

• Potential functional divergence among homologs from different genera within lactic acid bacteria

Unlike well-characterized membrane proteins involved in glycerol metabolism in L. sakei (such as those encoded by the glpKDF cluster), LSA1031 lacks clear functional annotations based on homology . This highlights the need for experimental characterization to determine its specific role. The genomic context of LSA1031 within the L. sakei chromosome may provide additional clues about its function through analysis of co-regulated genes or operonic organization.

Research approaches to leverage comparative genomics would include functional complementation studies, where homologs from different species are expressed in an LSA1031 knockout strain to assess functional conservation. Additionally, structural modeling based on homologous proteins with known structures could provide insights into potential functional sites within the protein.

What experimental design is most appropriate for studying LSA1031 function in stress adaptation?

A true experimental design represents the optimal approach for investigating LSA1031's function in stress adaptation. This methodology provides the necessary control and scientific rigor required for establishing causal relationships between LSA1031 expression and specific phenotypic outcomes.

The experimental design should incorporate the following key elements:

• Random selection of bacterial colonies for experimentation

• Random assignment of these colonies to experimental and control groups

• Precise manipulation of the independent variable (LSA1031 expression)

• Careful measurement of dependent variables (stress response parameters)

• Appropriate statistical analysis to determine significance of observed effects

A specific experimental framework could be structured as follows:

This balanced design allows for rigorous testing of LSA1031's role in stress adaptation by comparing phenotypic responses across different genetic backgrounds and environmental conditions. The inclusion of both knockout and complementation groups is crucial for establishing that observed phenotypes are specifically attributable to LSA1031 function rather than polar effects or secondary mutations .

For statistical validation, each experimental condition should include at least three biological replicates, with measurements taken at multiple time points to capture the dynamics of stress response. This approach has proven effective in previous studies characterizing stress-responsive proteins in L. sakei and provides the methodological rigor necessary for definitive functional characterization .

What proteomics approaches are most effective for studying LSA1031 interactions?

Comprehensive characterization of LSA1031 protein interactions requires an integrated proteomics strategy that combines multiple complementary approaches. Based on established methodologies for membrane protein analysis, the following techniques offer the most effective framework for investigating LSA1031's interaction network:

Affinity-Based Approaches:

• Pull-down assays using His-tagged recombinant LSA1031 as bait

• Co-immunoprecipitation with antibodies against LSA1031

• Tandem affinity purification for increased specificity in complex samples

Advanced Mass Spectrometry Techniques:

• Cross-linking mass spectrometry (XL-MS) to capture transient or weak interactions

• Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map interaction interfaces

• Label-free quantitative proteomics to identify differential interactions under stress conditions

In Vivo Interaction Validation:

• Bacterial two-hybrid systems adapted for membrane proteins

• Fluorescence resonance energy transfer (FRET) with fluorescently tagged protein pairs

• Split-GFP complementation assays for direct visualization of interactions

For membrane proteins like LSA1031, particular attention must be paid to maintaining the native membrane environment during extraction and analysis. Use of appropriate detergents or membrane-mimetic systems is essential for preserving physiologically relevant interactions. Additionally, when analyzing mass spectrometry data, specific filtering algorithms should be applied to distinguish true interactors from common contaminants in affinity purification experiments.

What are the optimal conditions for structural studies of LSA1031?

Structural characterization of membrane proteins like LSA1031 presents unique challenges that require specialized methodologies and optimized conditions. Based on current practices in membrane protein structural biology, the following conditions and approaches are recommended for LSA1031 structural studies:

Protein Preparation:

• Expression in specialized E. coli strains designed for membrane proteins

• Purification using tandem affinity tags to ensure high purity

• Detergent screening to identify optimal micelle-forming conditions

• Protein quality assessment via size-exclusion chromatography and thermal stability assays

Crystallization Approaches:

• Vapor diffusion methods with specialized membrane protein screening kits

• Lipidic cubic phase (LCP) crystallization for maintaining native-like lipid environment

• Use of crystallization chaperones or antibody fragments to stabilize flexible regions

• Microseeding techniques to improve crystal quality and size

Alternative Structural Methods:

• Cryo-electron microscopy for structure determination without crystallization

• Nuclear magnetic resonance (NMR) spectroscopy for dynamic structural information

• Small-angle X-ray scattering (SAXS) for low-resolution envelope determination

• Computational modeling based on homologous proteins with known structures

The optimal buffer conditions for LSA1031 structural studies would likely include:

For reconstitution experiments, the lyophilized protein should be solubilized following the recommended protocol to a concentration of 0.1-1.0 mg/mL , followed by buffer exchange into the optimized structural biology buffer. When preparing samples for structural studies, it's critical to maintain the protein in a monodisperse state, which should be verified by dynamic light scattering or analytical ultracentrifugation prior to crystallization attempts.

How should researchers analyze gene expression data related to LSA1031?

Gene expression analysis for LSA1031 requires a systematic approach that integrates multiple data types and analytical methods. Researchers should implement the following comprehensive workflow when analyzing expression data related to this membrane protein:

Experimental Design Considerations:

• Include appropriate biological replicates (minimum n=3) for statistical power

• Incorporate technical replicates to account for methodological variability

• Design time-course experiments to capture expression dynamics during stress adaptation

• Include relevant control conditions (standard growth, different stress types)

Data Preprocessing and Normalization:

• Quality control assessment of raw data (RNA integrity, sequence quality metrics)

• Removal of technical artifacts and batch effects

• Normalization using appropriate methods (e.g., RPKM/FPKM for RNA-seq, housekeeping genes for qRT-PCR)

• Log transformation of data when appropriate for statistical analysis

Statistical Analysis Framework:

• Differential expression analysis using appropriate statistical tests (e.g., DESeq2, edgeR for RNA-seq)

• Multiple testing correction (Benjamini-Hochberg procedure) to control false discovery rate

• Fold change thresholds (typically ≥2-fold) combined with p-value cutoffs (p<0.05)

• Time-series analysis for temporal expression patterns during adaptation

Functional Interpretation:

• Co-expression network analysis to identify genes with similar expression patterns

• Integration with proteomic data to correlate transcript and protein levels

• Pathway enrichment analysis to identify biological processes associated with LSA1031

• Comparison with known stress response pathways in Lactobacillus species

Previous studies on L. sakei have utilized two-dimensional electrophoresis to identify proteins with significant variation in expression under stress conditions . This approach can be complemented with transcriptomic analyses to provide a more comprehensive understanding of LSA1031 regulation. When analyzing such data, particular attention should be paid to the expression patterns of genes in the genomic vicinity of LSA1031, as they may be co-regulated or functionally related.

For visualization and interpretation, heat maps of expression values across conditions and time points, principal component analysis for sample clustering, and volcano plots for highlighting significantly differentially expressed genes represent effective approaches for identifying meaningful patterns in the data.

What comparative genomics approaches can reveal LSA1031 evolutionary significance?

Comparative genomics provides powerful insights into the evolutionary history and functional significance of LSA1031. Researchers should implement a multi-layered analytical approach that integrates sequence, structural, and contextual genomic information:

Sequence-Based Analysis:

• Multiple sequence alignment of LSA1031 homologs across bacterial taxa

• Phylogenetic tree construction to visualize evolutionary relationships

• Analysis of selection pressure (dN/dS ratios) to identify conserved functional domains

• Identification of sequence motifs that may indicate functional conservation

Genomic Context Analysis:

• Synteny mapping to compare gene neighborhoods across species

• Identification of conserved gene clusters suggesting functional relationships

• Analysis of regulatory elements in promoter regions

• Detection of horizontal gene transfer events that may have shaped LSA1031 evolution

Structural Homology Assessment:

• Comparison of predicted secondary structure elements across homologs

• Identification of conserved transmembrane topology patterns

• Analysis of conserved residues in predicted functional sites

• Structural superimposition of homology models to identify conserved spatial arrangements

The comparative analysis should extend beyond Lactobacillus to include diverse bacterial taxa, which can provide context for understanding the broader evolutionary history of this membrane protein family. Special attention should be paid to differences between homologs in bacteria adapted to different environmental niches, which may reveal adaptive signatures related to specific stress responses.

Unlike well-characterized protein families such as the glycerol metabolism components in L. sakei (GlpK, GlpD, GlpF), which show clear taxonomic distribution patterns and gene order conservation , the UPF0756 family remains less studied. Comparing the gene neighborhood architecture of LSA1031 with that of characterized systems like the glpKDF cluster can provide clues about its potential functional role in cellular physiology.

How can functional predictions for LSA1031 be validated experimentally?

Robust experimental validation of functional predictions for LSA1031 requires a systematic approach that integrates computational predictions with targeted experimental assays. The following comprehensive validation framework is recommended:

Initial Computational Predictions:

• Sequence-based functional prediction using tools like InterProScan and Pfam

• Structural modeling to identify potential functional sites

• Molecular docking simulations with predicted ligands or interaction partners

• Network-based functional inference from known interaction partners

Genetic Validation Approaches:

• Construction of knockout mutants using homologous recombination with integrative plasmids like pRV300

• Complementation studies with wild-type and mutated versions of LSA1031

• Site-directed mutagenesis of predicted functional residues

• Phenotypic characterization under various stress conditions

Biochemical Validation Methods:

• In vitro binding assays with predicted ligands or interaction partners

• Transport assays if LSA1031 is predicted to function as a transporter

• Enzymatic activity tests if catalytic function is predicted

• Structural studies to confirm predicted binding sites

Integrated Functional Genomics:

• Transcriptomic analysis of LSA1031 knockout vs. wild-type strains

• Metabolomic profiling to identify changes in cellular metabolism

• Suppressor mutation screening to identify genetic interactions

• Heterologous expression in different bacterial hosts to test function conservation

The validation strategy should be guided by the specific functional hypotheses generated through computational analysis. For instance, if LSA1031 is predicted to function in cold adaptation, experimental validation should focus on comparing growth and survival of wild-type and mutant strains at low temperatures, similar to approaches used for other stress-response proteins in L. sakei .

A decision tree approach is recommended, where initial validation experiments inform subsequent, more targeted assays. This iterative process ensures efficient use of resources while building a comprehensive body of evidence supporting specific functional roles for LSA1031. Importantly, multiple independent lines of evidence should be pursued to strengthen functional assignments, particularly for uncharacterized protein families like UPF0756.

What are the potential biotechnological applications of LSA1031 research?

Research on LSA1031 holds significant biotechnological potential across several domains, particularly given L. sakei's established role in food fermentation and preservation. Understanding the function of this membrane protein could enable several innovative applications:

Enhanced Starter Cultures:

• Development of L. sakei strains with optimized LSA1031 expression for improved stress tolerance

• Creation of starter cultures with enhanced performance in meat fermentation processes

• Engineering strains with extended viability during food product storage

• Optimization of cell membrane properties for specific food applications

Biopreservation Technologies:

• Exploitation of LSA1031's potential role in cold adaptation for improved food preservation

• Development of natural preservation systems based on enhanced L. sakei strains

• Creation of protective cultures with improved competitiveness against spoilage organisms

• Design of stress-resistant strains for extended shelf-life applications

Protein Engineering Applications:

• Use of LSA1031 as a scaffold for designing membrane proteins with novel functions

• Development of biosensors based on LSA1031's potential environmental sensing capabilities

• Creation of chimeric proteins combining LSA1031 domains with functional elements from other proteins

• Engineering of membrane-bound biocatalysts for biotransformation applications

Research Tools:

• Development of LSA1031-based expression tags for membrane protein localization

• Creation of reporter systems for monitoring environmental stress in bacterial cultures

• Design of experimental systems for studying membrane protein adaptation mechanisms

• Use as a model system for membrane protein folding and stability studies

The biotechnological applications would build upon L. sakei's established role in food fermentation and its ability to adapt to challenging environmental conditions like those encountered during meat processing . By understanding the molecular mechanisms underlying these adaptations, including the role of membrane proteins like LSA1031, researchers can develop more robust and effective bacterial cultures for food production and preservation applications.

Future development would require detailed characterization of LSA1031's function, followed by systematic engineering approaches to enhance or modify these functions for specific biotechnological applications. Collaborations between academic researchers and food technology companies would accelerate the translation of basic research findings into practical applications.

What research gaps remain in our understanding of LSA1031 function?

Despite available information on LSA1031, significant knowledge gaps persist that limit our comprehensive understanding of this membrane protein's function and biological significance. These research gaps represent important opportunities for future investigation:

Structural Characterization:

• Lack of high-resolution structural data for LSA1031

• Limited understanding of transmembrane topology and structural dynamics

• Absence of information on potential oligomerization states

• Insufficient knowledge about structural changes under stress conditions

Functional Mechanisms:

• Undefined molecular function (transport, sensing, or structural)

• Unknown substrates or ligands that interact with LSA1031

• Unclear signaling pathways or networks involving this protein

• Limited understanding of its role in membrane organization or integrity

Regulation and Expression:

• Incomplete characterization of transcriptional and post-transcriptional regulation

• Limited knowledge about expression patterns across growth phases and conditions

• Unknown post-translational modifications that may affect function

• Insufficient understanding of protein turnover and degradation mechanisms

Evolutionary Context:

• Unclear evolutionary origins and selection pressures

• Limited comparative analysis across diverse bacterial species

• Unknown functional divergence among homologs

• Insufficient understanding of co-evolution with interacting partners

Unlike some other L. sakei proteins involved in stress response or metabolism, such as those involved in glycerol utilization (GlpD, GlpK, GlpF) , LSA1031 lacks detailed functional characterization. While the protein has been identified and can be produced recombinantly , its specific contribution to L. sakei physiology remains largely speculative.

Addressing these knowledge gaps would require an integrated research approach combining structural biology, functional genomics, and systems biology perspectives. Priority should be given to establishing the basic functional role of LSA1031 through genetic approaches (knockout studies, complementation), followed by more detailed mechanistic investigations. Collaborative efforts between research groups with complementary expertise would accelerate progress in understanding this poorly characterized membrane protein.

What emerging technologies could advance LSA1031 research?

Emerging technologies across multiple fields present exciting opportunities to overcome current limitations in LSA1031 research and drive significant advances in our understanding of this membrane protein. The following cutting-edge approaches hold particular promise:

Advanced Structural Biology Techniques:

• Cryo-electron tomography for visualizing LSA1031 in its native membrane environment

• Micro-electron diffraction (MicroED) for structure determination from nanocrystals

• Integrative structural biology combining multiple data types (X-ray, NMR, cryo-EM)

• Hydrogen-deuterium exchange mass spectrometry for mapping dynamic structural changes

Single-Molecule Technologies:

• Single-molecule FRET to track conformational changes in real-time

• Atomic force microscopy for topological analysis of membrane-embedded LSA1031

• Single-particle tracking to monitor diffusion and clustering in membranes

• Optical tweezers to measure force generation or response to mechanical stimuli

Advanced Genomic Engineering:

• CRISPR-Cas9 genome editing for precise manipulation of LSA1031 in its native context

• CRISPRi/CRISPRa for tunable expression modulation without permanent genetic changes

• Base editing for creating specific amino acid substitutions without double-strand breaks

• Single-cell genomics to capture heterogeneity in LSA1031 expression and function

Computational and AI-Driven Approaches:

• AlphaFold2 and similar AI tools for improved structural prediction

• Molecular dynamics simulations in realistic membrane environments

• Network-based functional prediction algorithms integrating multiple data types

• Virtual screening and molecular docking for identifying potential interacting molecules

These technologies would complement traditional experimental approaches used in previous L. sakei research, such as two-dimensional electrophoresis and genetic knockout studies . For instance, while conventional methods identified proteins affected during growth at low temperatures, emerging technologies could provide unprecedented insights into the molecular mechanisms underlying these adaptations.

Implementation of these technologies would benefit from collaborative efforts between specialists in different fields. For example, structural biologists could partner with computational scientists to integrate experimental data with AI-driven predictions, while molecular biologists could work with biophysicists to apply single-molecule techniques to functional studies. Such interdisciplinary approaches would accelerate progress in understanding LSA1031's role in L. sakei physiology and potentially lead to novel biotechnological applications.