Recombinant Lactobacillus salivarius Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Lactobacillus salivarius Large-conductance Mechanosensitive Channel (mscL)

The Recombinant Lactobacillus salivarius Large-conductance mechanosensitive channel (mscL) is a protein derived from the bacterium Lactobacillus salivarius. This protein is part of a larger family of mechanosensitive channels, which play crucial roles in maintaining cellular osmotic balance by responding to changes in membrane tension. Mechanosensitive channels like mscL are essential for bacterial survival under varying environmental conditions, such as osmotic shock.

Structure and Function of mscL

The mscL channel is a pentameric structure composed of five identical subunits. It is activated by membrane tension, allowing ions to flow out of the cell, thereby reducing internal pressure and preventing cell lysis during osmotic downshock. The channel's large conductance allows it to efficiently release ions, making it a critical component in bacterial osmoprotection.

CharacteristicsDescription
Protein StructurePentameric structure composed of five identical subunits.
FunctionActivated by membrane tension to release ions and maintain osmotic balance.
ConductanceLarge conductance to efficiently release ions.

Recombinant Expression of mscL

Recombinant expression involves producing the mscL protein in a host organism using genetic engineering techniques. This allows for the large-scale production of the protein for research and potential therapeutic applications. Recombinant mscL can be expressed in various systems, including bacterial hosts like Escherichia coli, and can be purified for further study.

Potential Applications of Recombinant mscL

While specific applications of Recombinant Lactobacillus salivarius mscL are not widely documented, mechanosensitive channels in general have potential uses in biotechnology and biomedical research. For example, understanding how these channels function can inform the development of novel antimicrobial strategies or biosensors.

Potential ApplicationsDescription
Antimicrobial StrategiesTargeting mechanosensitive channels could lead to new antimicrobial drugs.
BiosensorsUtilizing mechanosensitive channels in biosensors to detect changes in membrane tension.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional fees.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mscL; LSL_0013; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-125
Protein Length
full length protein
Species
Lactobacillus salivarius (strain UCC118)
Target Names
mscL
Target Protein Sequence
MLKEFKEFISRGNVMDLAVGVIIGGAFTAIVNSLVKYIINPFLGLFVGAIDFSDLVFKIG NATFRVGSFLNAVINFLIIAFVVFLMVKGINKVLRQDKKEEAPAPKDPQLEVLEEIRDSL KKLDK
Uniprot No.

Target Background

Function
A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a regulatory role in cellular osmotic pressure changes.
Database Links
Protein Families
MscL family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.