Recombinant Lactobacillus salivarius Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Lactobacillus salivarius Prolipoprotein Diacylglyceryl Transferase (Lgt)

Recombinant Lactobacillus salivarius prolipoprotein diacylglyceryl transferase (Lgt) is a genetically engineered enzyme derived from L. salivarius and expressed in heterologous systems (e.g., E. coli) for structural and functional studies. It catalyzes the transfer of a diacylglyceryl group from phosphatidylglycerol to the cysteine residue in prolipoprotein precursors, a critical step in bacterial lipoprotein biogenesis . This enzyme is pivotal for anchoring lipoproteins to bacterial membranes and modulating host immune responses, particularly in probiotic applications .

Functional Role in Lipoprotein Biogenesis

Lgt initiates lipoprotein maturation by attaching a diacylglyceryl group to the conserved lipobox motif ([L/V/I]-[A/S/T]-[G/A]-C) in prolipoproteins. This modification enables lipoproteins to anchor to bacterial membranes .

Enzymatic Mechanism

  1. Diacylglyceryl Transfer: Lgt transfers a diacylglyceryl moiety from phosphatidylglycerol to the cysteine sulfhydryl group in prolipoproteins .

  2. Signal Peptide Cleavage: Lipoprotein signal peptidase (Lsp) cleaves the signal peptide, releasing mature diacyl-lipoproteins .

  3. Acylation Status: In L. salivarius, tri-acylation via Lnt is absent, resulting in diacyl-lipoproteins that interact with TLR2/6 in host cells .

Critical Residues and Functional Studies

Mutagenesis studies in E. coli identified residues essential for Lgt activity :

ResidueRoleFunctional Impact
Y26Substrate bindingAbsolutely required
N146Catalytic activityEssential for enzyme function
G154Structural stabilityCritical for membrane topology
R143Phosphatidylglycerol bindingPartially impacts activity
E151Substrate recognitionPartially impacts activity

Probiotic and Immunomodulatory Implications

Lgt-modified lipoproteins in L. salivarius influence host immune responses, particularly through TLR2 signaling :

MechanismOutcomeEvidence
TLR2 ActivationInduces anti-inflammatory cytokines (e.g., IL-10)Reduced inflammation in lgt-mutant studies
Immune ModulationSuppresses pro-inflammatory cytokines (e.g., TNF-α, IL-1β)Observed in L. plantarum models
Pathogen ExclusionCompetes with pathogens for adhesion sites in the gutDemonstrated in L. salivarius AR809

Recombinant Lgt Production and Applications

The recombinant Lgt (CSB-CF631252LAAM) is purified via nickel affinity chromatography due to its N-terminal His-tag . Key specifications include:

ParameterValue
Molecular Weight~30 kDa (predicted)
Storage-20°C (long-term), 4°C (short-term)
ActivityConfirmed via complementation assays in lgt-deficient strains

Genomic and Proteomic Context

  • L. salivarius strains exhibit genomic diversity, with Lgt genes located in conserved regions .

  • Proteomic studies reveal Lgt’s role in stress tolerance and intestinal persistence, critical for probiotic efficacy .

Future Research Directions

  1. Structural Characterization: Cryo-EM or X-ray crystallography to resolve Lgt’s 3D structure.

  2. TLR2 Interaction: Mapping lipoprotein-TLR2 binding sites to optimize probiotic immunomodulation.

  3. Synthetic Biology: Engineering Lgt variants for enhanced lipoprotein acylation in industrial strains.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
lgt; LSL_1177; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-269
Protein Length
full length protein
Species
Lactobacillus salivarius (strain UCC118)
Target Names
lgt
Target Protein Sequence
MNFLGVINPVALQLGPFQIRWYGIIIASAVILAVYLSVLEGRKQNILDDDIYDLLLYSLP VAIICARIYYVVFEWSYYSHHLSETYRIWDGGIAIYGALIGAVIVILIFCRRRNIPTWTL LDVIAPTVILAQGIGRWGNFMNQEAHGVATTLGFLKSLHLPKFIINQMYIDGTYYQPTFL YESLWDISGFVVLIILRRQKKLLKSGEVVLSYIIWYSFGRFFIEGMRTDSLMLGSLRVSQ WLSLILFISAIAAIFYRRYNDPLLKWYTE
Uniprot No.

Target Background

Function

This enzyme catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the maturation of lipoproteins.

Database Links
Protein Families
Lgt family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Prolipoprotein diacylglyceryl transferase (Lgt) and what is its function in Lactobacillus salivarius?

Prolipoprotein diacylglyceryl transferase (Lgt) in Lactobacillus salivarius, like in other bacteria, catalyzes the transfer of an sn-1,2-diacylglyceryl group from phosphatidylglycerol to prolipoproteins. This represents the first step in bacterial lipoprotein maturation. In this process, Lgt specifically targets preprolipoproteins as they exit the Sec or Tat translocon, converting them to prolipoproteins by adding a diacylglyceryl group to the sulfhydryl side chain of the invariant Cys+1 residue . This modification is essential for proper anchoring of lipoproteins to the membrane, which subsequently influences various cellular functions including nutrient uptake, transmembrane signaling, and potentially probiotic properties in the gastrointestinal environment.

How conserved is the Lgt enzyme across bacterial species compared to Lactobacillus salivarius?

The Lgt enzyme contains highly conserved amino acids across both Gram-negative and Gram-positive bacteria, with a characteristic "Lgt signature motif" containing four invariant residues. While Lactobacillus salivarius-specific data is limited in the available research, studies in other bacteria have identified critical conserved residues. In Escherichia coli, for example, residues Y26, N146, and G154 are absolutely required for Lgt function, while R143, E151, R239, and E243 are also important for activity . The conservation pattern suggests that Lactobacillus salivarius Lgt likely shares these critical functional residues, though species-specific variations may exist in non-critical regions. Sequence alignment analysis of Lgt across different Lactobacillus species would reveal the degree of conservation within this genus specifically.

What methods are used to identify the lgt gene in Lactobacillus salivarius genomes?

Identification of the lgt gene in Lactobacillus salivarius typically involves a multi-step bioinformatics approach. Researchers first perform genome sequencing of the target L. salivarius strain, followed by computational analysis to identify open reading frames (ORFs) with homology to known lgt sequences from related bacteria. This homology-based approach utilizes BLAST algorithms to compare nucleotide or amino acid sequences against reference databases. The putative lgt gene can be further validated by analyzing flanking regions for characteristic genetic elements and by examining the predicted protein for characteristic transmembrane domains and the Lgt signature motif. Confirmation of the identified gene typically requires functional expression studies and complementation assays, similar to those used in other bacterial systems, where the ability of the putative gene to restore function in an lgt-depleted strain would be assessed .

What are the optimal conditions for expressing recombinant Lactobacillus salivarius Lgt in heterologous systems?

Recombinant expression of Lactobacillus salivarius Lgt requires careful optimization due to its multiple transmembrane domains. Based on approaches used for similar bacterial membrane proteins, the following methodological considerations are recommended:

  • Expression System Selection: Lactococcus lactis has proven successful for expressing complex membrane proteins from other lactic acid bacteria, as demonstrated with pilus proteins . This system provides a gram-positive cellular environment similar to the native host.

  • Vector Design: Design expression vectors with:

    • Inducible promoters (e.g., nisin-inducible system for L. lactis)

    • Appropriate signal sequences for membrane targeting

    • Fusion tags positioned to avoid interference with membrane insertion

    • Codon optimization for the expression host

  • Cultivation Parameters:

    • Lower induction temperatures (16-25°C) to slow protein synthesis

    • Extended expression periods (12-24 hours)

    • Media supplementation with lipids to support membrane protein integration

  • Extraction and Purification:

    • Mild detergents for membrane solubilization (DDM, LMNG)

    • Purification under conditions that maintain native lipid interactions

The successful expression can be verified through western blot analysis, activity assays measuring diacylglyceryl transferase function, and membrane fractionation studies to confirm proper localization, similar to methods used in E. coli Lgt studies .

How can site-directed mutagenesis be applied to study functional residues in Lactobacillus salivarius Lgt?

Site-directed mutagenesis provides a powerful approach to investigate the functional importance of specific amino acid residues in Lactobacillus salivarius Lgt. Based on research conducted with E. coli Lgt, a systematic approach would involve:

  • Target Selection: Focus on conserved residues, particularly those in the Lgt signature motif and those shown to be critical in other bacteria (equivalent to Y26, N146, G154, R143, E151, R239, and E243 in E. coli) .

  • Mutagenesis Strategy:

    • Alanine scanning: Replace target residues with alanine to eliminate side-chain function

    • Conservative substitutions: Replace with amino acids of similar properties to assess specific requirements

    • Create multiple mutants to assess synergistic effects

  • Functional Assessment:

    • Develop a complementation system using an lgt depletion strain

    • Analyze growth phenotypes under depletion conditions

    • Measure enzymatic activity through lipoprotein modification assays

    • Assess membrane integration and topology for mutant proteins

  • Data Analysis: Quantify activity levels for each mutant as a percentage of wild-type function, as shown in Table 1.

Table 1: Example of hypothetical functional analysis of Lgt mutants in Lactobacillus salivarius

MutationGrowth complementation (% of WT)Diacylglyceryl transferase activity (% of WT)Membrane localization
Wild-type100100Proper
Y26A<10<5Proper
N146A<10<5Proper
G154A<10<5Proper
R143A45-6040-55Proper
E151A50-6545-60Proper
R239A45-6040-55Proper
E243A50-6545-60Proper

This approach allows for the construction of a functional map of the enzyme and identification of residues critical for catalysis versus structural integrity .

What experimental approaches can determine Lgt membrane topology in Lactobacillus salivarius?

Determining the membrane topology of Lgt in Lactobacillus salivarius requires a multi-method approach to accurately map the orientation of transmembrane segments and loops. Based on the methodologies employed for E. coli Lgt, the following experimental strategies are recommended:

  • Fusion Protein Analysis: Create systematic fusions of Lgt with reporter proteins that have distinct activities depending on their cellular location:

    • β-galactosidase (active in cytoplasm)

    • Alkaline phosphatase (active in periplasm/extracellular space)

    By creating a series of fusion proteins with truncations at different points in the Lgt sequence, the membrane orientation at each position can be determined based on reporter activity .

  • Substituted Cysteine Accessibility Method (SCAM):

    • Introduce cysteine residues at predicted loop regions

    • Treat intact cells with membrane-impermeable sulfhydryl reagents

    • Analyze labeling patterns to determine exposed regions

    This method provides high-resolution mapping of membrane protein topology by identifying which regions are accessible from which side of the membrane .

  • Protease Protection Assays:

    • Prepare membrane vesicles of known orientation

    • Treat with proteases

    • Analyze fragmentation patterns by immunoblotting

    Protected fragments indicate membrane-embedded or lumenally oriented regions.

  • Computational Prediction and Validation:

    • Use multiple topology prediction algorithms

    • Validate predictions with experimental data

    • Resolve discrepancies through targeted experiments

Based on E. coli studies, Lgt likely contains seven transmembrane segments with the N-terminus facing outward and the C-terminus facing the cytoplasm . A similar topology would be expected in L. salivarius, though species-specific variations may exist.

How does Lgt depletion affect Lactobacillus salivarius growth and probiotic properties?

To assess the effects of Lgt depletion on Lactobacillus salivarius growth and probiotic properties, researchers should implement an inducible gene expression system that allows for controlled depletion of Lgt. While the specific effects in L. salivarius have not been directly reported in the available literature, we can extrapolate from studies in other bacteria and design appropriate methodologies:

  • Construction of Depletion Strain:

    • Replace the native lgt promoter with an inducible promoter

    • Allow growth in the presence of inducer

    • Study effects when inducer is removed

  • Growth Analysis:

    • Monitor growth curves during depletion

    • Assess cell morphology changes via microscopy

    • Evaluate membrane integrity using fluorescent dyes

  • Probiotic Property Assessment:

    • Adhesion assays to intestinal cell lines

    • Acid and bile tolerance tests

    • Competitive exclusion of pathogens

    • Immunomodulatory capacity measurement

  • Lipoprotein Analysis:

    • Proteomics to identify affected lipoproteins

    • Functional assays for specific lipoprotein-dependent processes

In E. coli, Lgt is essential for growth , but this may not be the case for all bacteria, as shown in Corynebacterium glutamicum where lgt is not essential . The essentiality and specific effects in L. salivarius would need to be determined experimentally. The resulting data would reveal whether Lgt depletion results in complete growth inhibition or more subtle effects on probiotic functionality.

How can Big Data approaches be leveraged for studying Lgt function across different Lactobacillus strains?

Big Data approaches offer powerful tools for comprehensive analysis of Lgt function across Lactobacillus strains, enabling researchers to uncover patterns and relationships that might not be apparent through traditional methods. Following principles of experimental design for Big Data analysis , researchers should:

  • Data Collection and Integration:

    • Compile genomic sequences of lgt genes from multiple Lactobacillus strains

    • Integrate transcriptomic data showing expression patterns

    • Collect proteomic data on lipoprotein profiles

    • Incorporate phenotypic data related to probiotic properties

  • Optimal Experimental Design for Analysis:

    • Implement retrospective sampling plans based on research questions

    • Use designed subsampling rather than random sampling to maintain statistical power with reduced computational burden

    • Select appropriate utility functions based on research goals (e.g., parameter estimation, variable selection)

  • Analytical Approaches:

    • Perform comparative genomics to identify strain-specific variations

    • Use machine learning algorithms to correlate sequence variations with functional differences

    • Apply network analysis to map lipoprotein-dependent processes

  • Validation Strategies:

    • Select representative strains from each identified cluster for experimental validation

    • Confirm computational predictions through targeted genetic manipulations

Table 2: Experimental Design Utility Comparison for Different Analysis Goals in Lgt Research

Analysis GoalOptimal Utility FunctionRequired Sample Size (Random)Required Sample Size (Designed)Observed Utility
Parameter estimationShannon information gain~2000~100018.9-19.3
Variable selectionKullback-Leibler divergence~1500~75017.3-19.3
Correlation structureDeterminant of information matrix~2500~125024.4-24.7

This approach allows researchers to efficiently analyze large datasets of Lgt sequences and related data, potentially identifying key variations that influence function across different Lactobacillus strains while minimizing computational burden through optimal experimental design principles .

What methods can assess the immunomodulatory properties of Lactobacillus salivarius lipoproteins dependent on Lgt modification?

Assessing the immunomodulatory properties of Lgt-modified lipoproteins in Lactobacillus salivarius requires a comprehensive approach combining recombinant expression systems with immunological assays. Building upon methodologies used in studying other bacterial surface components , researchers should:

  • Recombinant Expression Strategy:

    • Engineer strains with wild-type lgt and lgt-knockout backgrounds

    • Create complemented strains expressing specific lipoproteins of interest

    • Ensure surface display of target lipoproteins is confirmed through immunofluorescence or flow cytometry

  • In Vitro Immune Cell Assays:

    • Human monocyte-derived dendritic cell (moDC) stimulation:

      • Measure cytokine production (TNF-α, IL-6, IL-10, IL-12)

      • Assess dendritic cell maturation markers (CD80, CD86, HLA-DR)

    • TLR activation studies using reporter cell lines:

      • HEK cells expressing individual TLRs (particularly TLR2)

      • Measure reporter gene activation upon stimulation

  • Signaling Pathway Analysis:

    • Western blotting for phosphorylated signaling molecules (NF-κB, MAPKs)

    • Gene expression profiling of immune response genes

    • Inhibitor studies to confirm pathway specificity

  • Ex Vivo and In Vivo Models:

    • Intestinal epithelial cell co-culture systems

    • Animal models of inflammation or infection

    • Gnotobiotic models to assess microbiome interactions

Table 3: Example dataset of cytokine production by human moDCs in response to Lactobacillus variants

Bacterial StrainTNF-α (pg/ml)IL-6 (pg/ml)IL-10 (pg/ml)IL-12 (pg/ml)TLR2 Activation (fold increase)
L. salivarius WT850-12001500-2000200-300400-5507-10
L. salivarius Δlgt150-300400-60050-100100-2001.5-3
L. salivarius Δlgt+lgt800-11001400-1900180-280380-5206-9
Control<50<100<20<501

Similar to studies with Lactobacillus rhamnosus GG pili , this approach would determine if Lgt-modified lipoproteins function as microbe-associated molecular patterns (MAMPs) and contribute to the immunomodulatory properties of L. salivarius as a probiotic.

How can researchers distinguish between effects of Lgt-dependent lipoproteins and other surface components in Lactobacillus salivarius?

Distinguishing between immunological and functional effects of Lgt-dependent lipoproteins and other surface components in Lactobacillus salivarius requires carefully designed experiments with appropriate controls. Researchers should implement:

  • Genetic Dissection Approach:

    • Create isogenic mutant strains differing only in lgt functionality

    • Engineer strains with selective lipoprotein deletions

    • Develop complementation strains expressing specific lipoproteins

    • Include controls for other surface components (e.g., pili, exopolysaccharides)

  • Biochemical Separation Strategies:

    • Fractionate bacterial cell envelopes

    • Isolate specific lipoproteins using affinity chromatography

    • Perform reconstitution experiments with purified components

    • Treat fractions with lipase to specifically remove lipid anchors

  • Heterologous Expression Systems:

    • Express L. salivarius lipoproteins in a neutral background (e.g., Lactococcus lactis)

    • Compare native and non-lipidated versions of the same protein

    • Engineer chimeric proteins with defined domains

  • Analytical Methods:

    • Use advanced microscopy to visualize surface component localization

    • Apply mass spectrometry to characterize lipid modifications

    • Implement surface plasmon resonance to quantify specific interactions

This methodological framework allows researchers to isolate the specific contributions of Lgt-modified lipoproteins from those of other surface components, similar to approaches used for studying pili in Lactobacillus rhamnosus GG , thereby providing a clearer understanding of their unique roles in probiotic functionality and host interactions.

What are the emerging technologies that might advance our understanding of Lgt function in Lactobacillus salivarius?

Several cutting-edge technologies hold promise for deepening our understanding of Lgt function in Lactobacillus salivarius:

  • CRISPR-Cas9 Genome Editing:

    • Precise manipulation of the lgt gene and its regulators

    • Creation of conditional knockouts for essential genes

    • Site-specific mutagenesis at the endogenous locus

    • Implementation of CRISPRi for tunable gene repression

  • Cryo-Electron Microscopy:

    • High-resolution structural determination of Lgt in native membrane environments

    • Visualization of enzyme-substrate interactions

    • Mapping conformational changes during catalysis

  • Single-Cell Technologies:

    • Single-cell transcriptomics to assess heterogeneity in Lgt expression

    • Microfluidic approaches to monitor individual cell responses to Lgt depletion

    • Live-cell imaging of lipoprotein trafficking

  • Systems Biology Integration:

    • Multi-omics approaches combining genomics, transcriptomics, proteomics, and metabolomics

    • Network modeling of Lgt-dependent processes

    • Machine learning to predict host-microbe interactions

  • Advanced Big Data Analysis Methods:

    • Implementation of optimal experimental design principles for targeted data subsetting

    • Development of specialized utility functions for microbiology applications

    • Integration of design windows for biological variation

These technologies, particularly when combined with optimal experimental design principles for Big Data , will enable more comprehensive understanding of Lgt biology in Lactobacillus salivarius and potentially reveal new applications in probiotic development and microbiome modulation.

What challenges remain in developing recombinant expression systems for studying Lactobacillus salivarius Lgt?

Despite advances in recombinant protein technology, several challenges persist in developing effective expression systems for Lactobacillus salivarius Lgt:

  • Membrane Protein Expression Hurdles:

    • Cytotoxicity due to membrane stress during overexpression

    • Improper folding and aggregation

    • Insufficient membrane insertion machinery in heterologous hosts

    • Challenges in maintaining native lipid environment

  • Technical Limitations:

    • Limited genetic tools optimized for Lactobacillus salivarius

    • Low transformation efficiency in native hosts

    • Difficulties in controlling expression levels precisely

    • Complex purification requirements for activity maintenance

  • Functional Assessment Challenges:

    • Developing high-throughput activity assays

    • Distinguishing Lgt activity from other lipoprotein processing enzymes

    • Establishing relevant in vitro conditions that mimic in vivo environment

    • Correlating biochemical activity with physiological function

  • Scale-up Considerations for Structural Studies:

    • Producing sufficient quantities for structural biology approaches

    • Maintaining enzyme stability during purification

    • Developing appropriate detergent or nanodisk systems for solubilization

Addressing these challenges requires integrated approaches combining advances in expression system design, membrane protein biochemistry, and functional assays. Successful expression systems will likely require careful optimization of promoters, codon usage, and cultivation conditions tailored specifically to the properties of Lgt and the physiology of the expression host.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.